KEGG   Aliivibrio salmonicida: VSAL_I1995Help
Entry
VSAL_I1995        CDS       T00782                                 

Definition
phospholipase A1 precursor (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vsa  Aliivibrio salmonicida
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VSAL_I1995
   00565 Ether lipid metabolism
    VSAL_I1995
   00590 Arachidonic acid metabolism
    VSAL_I1995
   00591 Linoleic acid metabolism
    VSAL_I1995
   00592 alpha-Linolenic acid metabolism
    VSAL_I1995
Enzymes [BR:vsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VSAL_I1995
    3.1.1.32  phospholipase A1
     VSAL_I1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2136897..2137670
Genome map
AA seq 257 aa AA seqDB search
MKKWMLLIAWALPFMTSAKALNRISGYEDSYLLGSYTDSINKDEYISGGFEDADGLQNVE
VKFQFSLAVPIVQINNSTSFMFSYTQKSLWQLGNSEISSPFRETNYKPQFFVMHQSNMLI
FNSAEFGYMHESNGQTSSLSRSWDRIYTGLERLDGPVQYGVRAWYVFSDEENNEDINDFM
APYDVWLKVGNDIGEFSTRFHYNFATDKGGVEAAYTLYVNQFVGLYVQGWTGYGETLIDY
NYDHSRIGIGMRLLPPN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggatgctattaattgcatgggctctaccctttatgacatctgcaaaagcg
cttaatcgtatatctggttatgaagacagctatttattaggaagttacaccgatagtatc
aacaaagatgaatacatttcaggaggctttgaagacgctgatggccttcaaaatgtggaa
gtgaaatttcagttttctttagcggtgccgatcgttcaaattaataacagcacttcattc
atgttctcttatacgcaaaagtcgctatggcaactagggaatagcgagatttcatcgcct
tttagagaaacgaactataagcctcagttttttgttatgcatcaatcaaacatgctgatt
tttaatagtgcagaatttggttatatgcatgaatcaaatggtcaaacatcgagtttatca
cgcagttgggatcgtatttatactggattagagcgtcttgatggcccagtgcaatacggt
gttcgtgcatggtatgtgttcagcgacgaagaaaacaatgaagacattaatgattttatg
gctccttatgatgtgtggctaaaagtcggtaatgatattggtgaattttctacacgattc
cattacaactttgctaccgataaaggtggcgtagaggcggcgtatacactttatgtaaac
cagtttgtcggtctctatgtacaaggttggacggggtatggtgagacgctgattgattat
aattatgatcacagtcgcattggtattggtatgagattacttccaccaaattaa

DBGET integrated database retrieval system