KEGG   Aliivibrio salmonicida: VSAL_I2439Help
Entry
VSAL_I2439        CDS       T00782                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00620  Pyruvate metabolism
vsa00630  Glyoxylate and dicarboxylate metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa01200  Carbon metabolism
Module
vsa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VSAL_I2439 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    VSAL_I2439 (aceB)
Enzymes [BR:vsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VSAL_I2439 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CAQ80123
UniProt: B6EK69
Position
1:complement(2611482..2613086)
Genome map
AA seq 534 aa AA seqDB search
MTDTMTTTEQSLSIIAPNSLQREEILTSGAIRFLTHVVDKFAHRIPELLNTRQDRQRQID
AGQLPDFLQETRSIRESEWTIQGIPTDLQDRRVEITGPTDRKMVINALNANVKVFMADFE
DSLAPSWEAVLDGQINLRDAMNGTIQYTNPETGKVYQLKQDPAVLICRVRGLHLPEKHVL
FNGVPIPGALFDFALYFYHNYQTSLKKGSGPYFYLPKLQAYQEAAWWSDVFSFAEREFGL
KQGTIKATVLIETLPAVFEMDEILYSLKEHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDR
QAVTMEKPFLNAYSRLLIRTCHRRAAFAMGGMAAFIPSKDPVKNDWVLNKIKTDKSLEAN
NGHDGSWVAHPGLADTARAEFDKVLGERSNQLDISRDTDAPITAEELLARCEGERTEEGM
RHNIRVAVQYIEAWITGNGCVPIYGLMEDAATAEISRTSIWQWIQHGKTLDNGDTVTADL
FRTMLLEEMKIIEEELGTERFDSGQFIQAAKLMEQLTTSDQLTDFLTLTGYDYL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgacagataccatgacaaccacagaacaatcactctcaataattgctcctaatagctta
caaagagaagaaatattaacgtctggcgcaatacgtttccttactcatgttgtcgataag
tttgctcaccgcattccagaattacttaatactcgtcaggatcgtcagagacaaattgat
gcaggccaattgcccgattttttacaagaaacgcgctctattcgagaatctgaatggacg
attcaagggatacccactgaccttcaagaccgaagagttgaaattactggaccgacagat
agaaaaatggtgatcaatgcattgaatgcgaatgtaaaagtattcatggccgattttgaa
gattcattagcaccttcttgggaggctgtgctagatggacagataaacctgagagatgca
atgaacggcacgattcagtacaccaacccagaaacggggaaggtgtaccaactaaaacaa
gatcctgctgtattgatttgtcgcgttcgtggtctacatcttcctgaaaaacatgtgcta
tttaatggtgtacctattcccggtgctttatttgattttgctctctatttttaccacaat
tatcaaacgtcattaaagaaaggcagtggtccttacttttatctgcctaaattacaagct
taccaagaagccgcgtggtggagtgatgtgtttagttttgcagagcgagaattcggatta
aagcaaggcacaataaaagcaacagtattgattgaaacattgcctgctgtgtttgagatg
gatgaaatattatatagccttaaagagcatattgttggattgaactgtggtcgatgggat
tacatttttagctacattaaaacacttaaaaatcatcccgaccgtgtattgcccgatcgc
caagcggtgacaatggaaaaaccgtttttaaatgcctattcacgattactgatcagaacc
tgtcaccgaagagccgcatttgcgatgggaggaatggccgcctttattccatcaaaagac
ccggtaaaaaatgattgggttttaaataaaattaaaacggataaatcattagaagcaaat
aatggacacgacggaagttgggttgctcatccgggactggctgataccgcaagagctgaa
tttgacaaggtattgggtgagcgctctaaccagttagacattagccgagatactgatgcg
ccaattacggctgaagaactattagcacggtgtgaaggcgaaagaacagaagagggaatg
cgtcataatattcgagtcgcagttcaatacattgaagcgtggataacgggtaatggatgc
gtccctatttatggattaatggaagatgccgcaacggcagaaatatcacgaacgtctatt
tggcaatggatacaacatggaaagacactagataacggtgacacagtgaccgcggatctg
tttagaaccatgttattagaagaaatgaaaataatagaagaggagttgggaactgaacgt
tttgattcaggacaatttattcaagcagcaaaactgatggagcaattaaccaccagcgat
caactaacggactttttaacactcactggctatgactatttataa

DBGET integrated database retrieval system