KEGG   Aliivibrio salmonicida: VSAL_I2554Help
Entry
VSAL_I2554        CDS       T00782                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vsa  Aliivibrio salmonicida
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VSAL_I2554 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VSAL_I2554 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VSAL_I2554 (thrC)
Enzymes [BR:vsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VSAL_I2554 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2734134..2735417)
Genome map
AA seq 427 aa AA seqDB search
MKLYNIKENDEKVSFGQAVRQGLGRNQGLFFPSELPTFDDIDTLLADDFISRSTKILSAF
IGDELPQDTVRNMVENAFQFPAPIHAVKDGVYALELFHGPTLAFKDFGGRFMAQSLAAVT
EGNDKITILTATSGDTGAAVAHAFYGMDNINVVILYPKGKISPLQEKLFCTLGGNIHTVA
VDGDFDDCQALVKQSFDDADLRKEIGLNSANSINISRLMAQICYYFEAVSQLPKEKRDDV
VISVPSGNFGNLTAGLLAKSLGLPVKRFIAATNVNDTVPRYLETGQWEPKTTIPTISNAM
DVSQPNNWPRIEELCQRLGWGLETLGKGAVTDAQSAETLKEMHAEGYLCEPHGAIAYRIL
NEQLAEGEIGLFLCTAHPAKFKEVVDDILGGDLDLPAPLAKHNAMELLSEDLANNFDDLK
EVLRKVQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtacaacataaaagaaaacgatgagaaagtctcttttggccaagccgttcgc
caaggtttaggtcgtaatcaaggactgttttttccatctgaactgcctacgtttgatgat
atagatacacttctggccgacgattttatttcccgtagtactaagattttatctgcgttt
attggtgatgaattgccacaagatactgttagaaatatggttgagaatgcatttcaattt
cccgcacctattcacgcagttaaagatggcgtttatgcactagaattatttcacggtcca
acattagcgtttaaagattttggtggccgttttatggctcagtctttagccgcagtgaca
gaagggaatgataaaattacgattctaaccgcgacatctggtgatactggagctgctgtt
gctcatgccttttatggtatggataatattaatgtcgtgatcttatatccgaaaggtaaa
ataagcccattacaagaaaagctattttgtactctgggtggcaatattcataccgttgcc
gttgatggtgactttgatgattgtcaggcattggttaagcaatcttttgatgatgccgat
ttacgtaaagaaattggattaaactcagctaactcaattaatattagtcgtttaatggct
caaatttgttattactttgaagccgtttctcagctaccaaaagaaaagcgtgatgatgtc
gttatttcagtaccaagtggtaattttggtaacttaacagcgggtttattagctaagtct
ttaggcttacctgttaaacgctttattgctgcgacaaatgtaaatgatacggtgccacgt
tatcttgaaacggggcaatgggaaccaaaaacaacgattcctacaatttcaaatgccatg
gatgtgagccaaccaaataactggcctcgtattgaagagctttgccaacgtttaggctgg
gggcttgaaacgctaggtaaaggtgcagtcactgatgctcagagtgcagaaacattaaaa
gaaatgcatgcagaaggctacttatgtgaacctcatggtgcgatagcttatcgtattttg
aatgagcaattagctgagggtgagattggcttatttttatgtacagcccatcccgctaag
tttaaagaagttgtcgatgatattttaggcggagatcttgatcttccagcgccattagcg
aaacataatgcaatggagttattgtctgaagatcttgctaataactttgatgatctaaaa
gaagtattgcgtaaagttcaataa

DBGET integrated database retrieval system