KEGG   Aliivibrio salmonicida: VSAL_I2640Help
Entry
VSAL_I2640        CDS       T00782                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  
cell division protein FtsZ
Organism
vsa  Aliivibrio salmonicida
Brite
Chromosome [BR:vsa03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    VSAL_I2640 (ftsZ)
Cytoskeleton proteins [BR:vsa04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   VSAL_I2640 (ftsZ)
Prokaryotic defense system [BR:vsa02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    VSAL_I2640 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(2856272..2857507)
Genome map
AA seq 411 aa AA seqDB search
MFEPMMEMSDDAVIKVVGVGGGGGNAIEHMVRESIEGVEFISVNTDAQALRKTSVNTVIQ
IGGDITKGLGAGANPQVGRDAALEDREAIKEALMGADMVFIAAGMGGGTGTGAAPIIAEV
ARELNILTVAVVTKPFSFEGRKRLAFAEQGIEELSKHVDSLITIPNEKLLKVLGRGITLL
EAFAKANDVLRNAVQGIAELITRPGMINVDFADVRTVMSEMGHAMMGSGVAVGEERAEEA
AEMAISSPLLEDIDLAGARGVLVNITAGLDMRLDEFETVGNTVKAFASDNATVVIGTSLD
PDMTDEIRVTVVATGIGTEKKPEITLVTNKATSAPAQQTPAAQVKPKAEAPVVEPVVEKA
AQNVQVTKPASQQTTSTSPAAGVQNAGAAQAKPDQKEDYLDIPAFLRRQAD
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagccgatgatggaaatgtccgacgacgcagtaattaaagttgttggtgtaggt
ggcggtggcggtaatgccattgaacacatggtacgtgagtcaattgaaggcgttgagttt
atcagtgtaaatactgatgctcaggcacttcgtaagacgagtgtaaacacagttattcag
attggtggagacatcacgaaaggcttaggtgcaggtgcaaacccacaagtaggccgtgat
gcagctctagaagatcgagaagcgattaaagaagctctgatgggtgccgatatggtattt
attgcagcgggcatgggtggcggtacaggtactggtgcggctccaattattgctgaagtt
gcaagagagctgaacatcttgaccgttgctgtcgtaacaaagccatttagctttgaaggt
cgtaagcgtcttgcttttgctgagcaaggaatcgaagaattatcaaaacatgttgattca
ttaattacgattccaaatgaaaaattacttaaagtacttggtcgtggtattacgttatta
gaagcgtttgcgaaagcaaatgatgttcttcgtaatgcagttcaaggtattgctgagtta
attactcgtccaggtatgatcaacgtcgatttcgcggatgttcgtacggtaatgtctgaa
atgggacatgcaatgatgggtagcggcgtcgccgttggtgaagaaagagcagaagaagcg
gctgagatggctatctcaagcccattgcttgaagatatcgatttggctggtgctcgtggt
gttcttgttaacattactgctggtcttgatatgcgccttgacgaatttgaaaccgttggt
aacacagtaaaagcatttgcttcagataatgcgacagtcgttattggtacgtctttagac
cctgatatgactgatgaaattcgagttactgtagttgcgactggtatcggcactgaaaaa
aagcctgaaattacattagtaacaaataaagcaacatcagcgccagcacaacaaacacca
gcggctcaagttaagccaaaggcagaagctcccgttgttgaaccggttgttgagaaagcg
gcacaaaatgtgcaagtaactaaaccagcatcacagcaaacaacatcgacctctccggcg
gctggtgttcaaaatgcaggtgcagcacaagctaaaccagatcaaaaagaagattattta
gatatcccggcgttcttacgtcgtcaagctgactaa

DBGET integrated database retrieval system