KEGG   Aliivibrio salmonicida: VSAL_I2649Help
Entry
VSAL_I2649        CDS       T00782                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-dia minopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vsa  Aliivibrio salmonicida
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    VSAL_I2649 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VSAL_I2649 (murE)
Enzymes [BR:vsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     VSAL_I2649 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2867283..2868764)
Genome map
AA seq 493 aa AA seqDB search
MMQLSELLLPWCELNQVVEISSMTLDSRKVTTGCLFVAIKGHAVDGRQFIPVAIKQGASA
VLAQSDEVNKTGTISFLDQTPIIYLDALSIKLSAVAGRFYHAEQRKMQLVGITGTNGKTT
ISQIIAQWATLLGKPAGVMGTTGNGLLTDLKPALNTTGSPIEIQQTLTDLENIGAKLTAL
EISSHGLVQGRVNALNFDAAVFTNLSRDHLDYHGDMANYAEAKKLLFTSHSPKYSIINAD
DTVGASWLKELPNAVGVSLNEGNLSFHSGKKVFATSVIYSTDGIQISLNSDWGTADLSVP
LIGAFNANNILVAFATLLSLGYDITELADAAPKLTAVIGRMELFSSEGNAKVVVDYAHTP
DALDKALQALRVHCEGKLWCIFGCGGDRDTGKRPMMASIAEQQADVIILSDDNPRSEDPS
LITKDMLAGLNQPDIAHVIHQRFDACQFALSQASKHDIILLAGKGHEEYQVLATETIHYS
DRETAQKLLGLSS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagttatctgaattattgttgccttggtgtgaattaaatcaagtcgtagaaata
tcatccatgacattggacagtcgtaaagtaaccactggttgcctatttgttgcgattaaa
ggccacgcggtcgatggccgacaatttatccctgttgcgattaagcaaggtgcatcggcg
gtattggctcaaagtgatgaggttaataagacgggaaccattagttttctcgatcagacc
cctattatttatctcgatgcgctatcgataaaactcagcgcggtcgctgggcgtttttat
cacgctgaacaaagaaaaatgcagttggttggcattactggaaccaatggaaaaacaacc
atatcgcaaattattgctcaatgggccacattacttggtaaaccagctggagtcatgggg
accacgggcaatggattattaaccgatctgaaacctgcgttaaatacgacgggtagccca
atcgagatccaacagacattaacggatcttgaaaatataggggcaaagctaaccgcatta
gaaatatcttctcatgggttggttcaagggcgtgttaatgccttgaattttgatgctgct
gtattcactaatttaagtcgtgatcacttagattatcatggtgatatggcaaattatgct
gaagcaaaaaaactgttgtttacctctcacagtcctaaatattcaatcattaatgccgat
gatactgtgggtgcttcttggttaaaagaattgcctaatgctgtcggggtatcattgaac
gaaggtaatctttcttttcattcagggaaaaaagtgtttgcaacttctgtcatttattct
acggatggaattcaaatatctctgaattctgattggggaaccgcggatctttctgttccg
ttgatcggtgcgtttaatgccaataatattttagttgcttttgctactcttctatcgctt
ggttacgacataactgaattagcggacgccgctcctaaattaaccgcggttattggacga
atggagcttttcagttctgaaggtaatgcgaaagtggttgtggactatgcacatactcca
gatgctttagataaagccttgcaagcccttcgagttcattgtgaaggcaagctgtggtgt
atatttggttgtggcggtgatcgagatacgggcaagcgtccgatgatggctagtattgct
gagcaacaagctgatgtgattattttaagtgatgataatcctcgttcagaagatccaagc
ttgattactaaagacatgttagctggtttgaaccaaccagacattgcacacgtgatacat
cagcgttttgatgcatgccagtttgctctctctcaagcaagtaagcatgatattatttta
ttggcaggcaaggggcatgaagaatatcaagtgcttgctacagaaacgattcattattct
gatcgtgaaactgcgcagaaattattaggactatcatcatga

DBGET integrated database retrieval system