KEGG   Aliivibrio salmonicida: VSAL_I2726Help
Entry
VSAL_I2726        CDS       T00782                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
vsa  Aliivibrio salmonicida
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VSAL_I2726 (rpe)
   01230 Biosynthesis of amino acids
    VSAL_I2726 (rpe)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VSAL_I2726 (rpe)
   00040 Pentose and glucuronate interconversions
    VSAL_I2726 (rpe)
Enzymes [BR:vsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     VSAL_I2726 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2952552..2953229
Genome map
AA seq 225 aa AA seqDB search
MKDFLIAPSILSADFARLGEDVDKVLASGADVVHFDVMDNHYVPNLTFGAPICKALRDYG
ITAPIDVHLMVKPVDSIVPEFAKAGATMITFHVEASEHVDRTLQLIKEHGCKAGVVLNPA
TPLSCLDYILDKVDMILLMSVNPGFGGQSFIPSTLDKLRAVRKLIDDSGRDIRLEIDGGV
KVDNIREIAEAGADMFVAGSAIFNQPNYKEVIDEMRAELAKVKGN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattttttgatcgcaccatctattctctctgctgattttgctcgtcttggtgaa
gacgtagacaaagtattagcgtcaggcgctgatgtggttcactttgatgtgatggataac
cactacgtaccaaacttaacgttcggtgcgccgatttgtaaagcgttacgtgattacggt
attaccgctccaattgatgtgcatttgatggtgaaaccagtggacagtattgttcctgag
tttgcaaaagccggtgcaacaatgatcactttccatgttgaagcatctgaacatgttgat
cgtacccttcagttaattaaagagcacggctgtaaagcgggtgttgttcttaatcctgca
acgccattatcctgtcttgactacattcttgataaagtcgatatgatcttacttatgtca
gttaatccgggttttggtggtcagtcatttattcctagtacgttagataaattgcgtgca
gtacgtaaattgatcgatgactctggtcgtgatatccgtcttgaaattgatggtggcgta
aaagtggataacattcgtgaaatcgcagaagcgggcgcggatatgtttgtggcaggctct
gcaatctttaatcaaccaaattataaagaagtgatagatgaaatgcgtgctgaactcgct
aaagtgaaaggtaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system