KEGG   Aliivibrio salmonicida: VSAL_I2726Help
Entry
VSAL_I2726        CDS       T00782                                 

Gene name
rpe
Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00030  Pentose phosphate pathway
vsa00040  Pentose and glucuronate interconversions
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa01130  Biosynthesis of antibiotics
vsa01200  Carbon metabolism
vsa01230  Biosynthesis of amino acids
Module
vsa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vsa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VSAL_I2726 (rpe)
   00040 Pentose and glucuronate interconversions
    VSAL_I2726 (rpe)
Enzymes [BR:vsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     VSAL_I2726 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C His_biosynth VASP_tetra TMP-TENI CutC
Motif
Other DBs
NCBI-ProteinID: CAQ80410
UniProt: B6EM47
Position
1:2952552..2953229
Genome map
AA seq 225 aa AA seqDB search
MKDFLIAPSILSADFARLGEDVDKVLASGADVVHFDVMDNHYVPNLTFGAPICKALRDYG
ITAPIDVHLMVKPVDSIVPEFAKAGATMITFHVEASEHVDRTLQLIKEHGCKAGVVLNPA
TPLSCLDYILDKVDMILLMSVNPGFGGQSFIPSTLDKLRAVRKLIDDSGRDIRLEIDGGV
KVDNIREIAEAGADMFVAGSAIFNQPNYKEVIDEMRAELAKVKGN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattttttgatcgcaccatctattctctctgctgattttgctcgtcttggtgaa
gacgtagacaaagtattagcgtcaggcgctgatgtggttcactttgatgtgatggataac
cactacgtaccaaacttaacgttcggtgcgccgatttgtaaagcgttacgtgattacggt
attaccgctccaattgatgtgcatttgatggtgaaaccagtggacagtattgttcctgag
tttgcaaaagccggtgcaacaatgatcactttccatgttgaagcatctgaacatgttgat
cgtacccttcagttaattaaagagcacggctgtaaagcgggtgttgttcttaatcctgca
acgccattatcctgtcttgactacattcttgataaagtcgatatgatcttacttatgtca
gttaatccgggttttggtggtcagtcatttattcctagtacgttagataaattgcgtgca
gtacgtaaattgatcgatgactctggtcgtgatatccgtcttgaaattgatggtggcgta
aaagtggataacattcgtgaaatcgcagaagcgggcgcggatatgtttgtggcaggctct
gcaatctttaatcaaccaaattataaagaagtgatagatgaaatgcgtgctgaactcgct
aaagtgaaaggtaattaa

DBGET integrated database retrieval system