KEGG   Aliivibrio salmonicida: VSAL_I2794Help
Entry
VSAL_I2794        CDS       T00782                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase isozyme 1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00010  Glycolysis / Gluconeogenesis
vsa00030  Pentose phosphate pathway
vsa00051  Fructose and mannose metabolism
vsa00052  Galactose metabolism
vsa00680  Methane metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa01130  Biosynthesis of antibiotics
vsa01200  Carbon metabolism
vsa01230  Biosynthesis of amino acids
vsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VSAL_I2794 (pfkA)
   00030 Pentose phosphate pathway
    VSAL_I2794 (pfkA)
   00051 Fructose and mannose metabolism
    VSAL_I2794 (pfkA)
   00052 Galactose metabolism
    VSAL_I2794 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VSAL_I2794 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VSAL_I2794 (pfkA)
Enzymes [BR:vsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VSAL_I2794 (pfkA)
Protein phosphatases and associated proteins [BR:vsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VSAL_I2794 (pfkA)
Messenger RNA biogenesis [BR:vsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VSAL_I2794 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAQ80478
UniProt: B6EMS4
Position
1:complement(3026252..3027214)
Genome map
AA seq 320 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAVRGVVRTALTQGLEVFGIHDGYLGLVEDRIEKLERHSVSD
MINRGGTFLGSARFPEFKEVAVREKAIANLKKHDIDALIVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLM
AAIAGGCEYVITPETGLNKEALIQNIQDGIAKGKKHAIIAITELMTDVNALAKEIEAETG
RETRATVLGHIQRGGQPGAFDRILASRMGNYGVKLLVEGHGGRCVGIQNEQLVHHDIIDA
IENMRRPEKLELYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaagattggtgttttaacaagtggtggcgatgcgccgggtatgaatgctgca
gttcgtggtgttgttcgtacagccttaacgcaaggtttagaagtattcggtattcatgat
ggctacttaggtcttgttgaagatcgtatcgagaaattagagcgccatagcgtatctgat
atgatcaaccgcggcggtacatttttaggttcagcacgttttcctgaatttaaagaagtg
gctgttcgtgaaaaagcgatcgcaaatcttaagaaacacgatattgatgccttaattgtt
atcggtggtgatggttcttacatgggcgctaagaagttaactgagatgggttacccatgt
atcggtcttcctggcactatcgataatgatattgcgggtactgactatacaattggttac
ttaacggcattaaacaccgttattgatgcgattgaccgtttacgtgatacatcgtcttct
caccaacgtatttctattgtagaagttatgggtcgtcactgtggtgatttgactttaatg
gctgcaattgccggtggttgtgaatatgtaattacacctgaaacggggttaaacaaagaa
gcattaattcaaaatatccaagatggtattgcgaaaggtaagaaacacgcaatcattgcg
attactgaattgatgactgatgtaaacgcattagcaaaagaaatcgaagcagaaacaggt
cgtgagactcgtgctacggttcttggtcacattcaacgtggcggtcagcctggtgcattc
gaccgtattttagcgtctcgtatgggtaattacggtgttaagttgcttgttgaaggtcat
ggcggtcgctgtgttggtatccaaaatgaacaacttgttcatcacgatattatcgatgcg
attgaaaatatgcgtcgtcctgagaagctagaactttataaagtagcggaagagttattc
taa

DBGET integrated database retrieval system