KEGG   Aliivibrio salmonicida LFI1238: VSAL_I2833Help
Entry
VSAL_I2833        CDS       T00782                                 

Gene name
acs
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vsa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vsa00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:vsa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3071562..3073511
Genome map
AA seq 649 aa AA seqDB search
MSDIHVYPVNQDIAKNAHADEDKYREMYQQSVINPEGFWREHGQIVDWMTPYTKVKNTSF
DTGHVDIKWFEDGELNVSANCIDRHLAARGDEVAIIWEGDDPQDDASITFNELHEQVCKF
SNALKSQGVRKGDVVCIYMPMVAEAAIAMLACTRIGAVHTVVFGGFSPEALAGRIVDSDA
KVVITADEGVRGGRTVPLKKNVDDALNNPEVTTIEKVVVFQRTGNDIDWNEERDVWWHEA
TAVASAHCEPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTFKYIFDYQEGEV
FWCTADVGWITGHTYLIYGPLANGAKTILFEGVPNYPSTSRMSEVVDKHNVNILYTAPTA
IRALMAHGNDAVEGTSRSSLRVMGSVGEPINPEAWEWYYNTIGDARCPIVDTWWQTETGG
ILISPLPGATALKPGSATRPFFGVQPALVDNMGNLIEGAADGNLVITDSWPGQMRTIYGD
HDRFEQTYFSTFKGMYFTSDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEVESALVSFS
KIAEAAIVGVPHDIKGQAIYAYITLNSGEYPSAELHKEVKDWVRKEIGPIATPDFLHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVNKLIEEQRKIA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacattcacgtatacccagtcaatcaagacatcgcaaaaaatgcacatgccgat
gaagataaataccgtgaaatgtatcagcaatccgtcatcaatcccgaagggttttggcgt
gagcacggacaaatagtcgactggatgactccttatactaaagtgaaaaacacctcgttc
gatactggtcacgtagacatcaaatggtttgaagatggtgaattgaatgtctctgcaaac
tgtatcgatcgccatcttgctgctcgcggtgatgaagtcgcgatcatctgggaaggtgac
gatccacaagatgatgcatcaattaccttcaatgagctgcacgaacaagtgtgtaaattc
tcaaacgcacttaagagtcaaggcgttcgcaaaggcgatgttgtgtgtatttacatgcca
atggttgcagaagcagccattgcaatgcttgcttgtactcgcattggtgcggttcatacc
gttgtttttggtgggttctcaccagaagcattggcgggtcgaatcgttgattcagatgcg
aaagtcgtgattaccgccgatgaaggcgttcgtggcggtcgtaccgtacctctaaagaaa
aacgtcgacgatgcattaaataaccctgaagtaacaaccattgaaaaagtcgttgtattc
caacgcaccggtaatgatattgattggaatgaagaacgcgatgtatggtggcatgaagca
accgctgtagcttctgcgcattgtgaaccagaagccatgaatgcggaagatcctcttttc
attctttatacctcaggctcaacaggtaaaccaaaaggcgtattacacaccactggcggc
taccttgtttatgcagcaatgaccttcaaatacatctttgattaccaagaaggtgaggtg
ttctggtgtaccgctgatgtaggttggatcactggccatacttatttaatctacggacct
ctcgctaatggcgcaaaaaccattctgtttgaaggggtaccaaactacccaagcactagc
cgcatgagtgaagtggtcgataagcacaacgtaaatattctttatactgcgccaacagcc
attcgagcactcatggctcacggtaatgacgctgtagaagggacctcaagatcctcatta
cgcgtgatgggatccgtcggcgaaccgatcaaccctgaagcatgggagtggtattacaac
accattggtgacgctcgctgcccaatcgttgatacgtggtggcaaaccgaaacgggcggg
attttaatctctcctcttcctggtgcaacggctttaaaaccgggctcggcaacacgtcct
ttctttggtgttcaaccagctttggttgataacatgggtaaccttattgaaggtgctgcc
gatggaaacctcgtgattaccgattcatggccgggtcaaatgcgcaccatttatggcgat
cacgaccgtttcgaacaaacttatttttcaacgtttaaaggcatgtattttaccagtgat
ggtgctcgacgtgatgaagatggttattactggataacaggtcgtgttgatgatgtgctc
aatgtgtctggtcaccgaatgggtaccgctgaagttgaatccgccttagtttctttcagt
aaaattgcagaggctgccattgtcggtgttcctcatgatattaaaggccaagcgatttac
gcatacatcaccttaaattcgggcgaatacccaagtgctgagctccataaagaagtcaaa
gattgggtaagaaaagaaataggccctatcgcaacacctgatttcttgcattggaccgac
tcattaccaaaaacacgttcagggaaaataatgcgtcgaattcttcgtaaaattgcgacg
ggagatacttcaaatctaggcgatacatccacacttgccgaccctagcgtggttaataaa
ctaattgaagaacaaagaaaaattgcttaa

DBGET integrated database retrieval system