KEGG   Aliivibrio salmonicida: VSAL_I2931Help
Entry
VSAL_I2931        CDS       T00782                                 

Definition
lysophospholipase L2 LypA
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vsa  Aliivibrio salmonicida
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VSAL_I2931
Enzymes [BR:vsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VSAL_I2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3176743..3177711
Genome map
AA seq 322 aa AA seqDB search
MTAPELTQEPQYHDTMKYNVAPFWEKRQHGFLQGEKTTQLHWVSFTSPSHKKAIMVVNGR
IESVYKYQELFYDLFCQGYDIYSFDHRGQGLSDRLTDNIDIGHIEDFNDYILDLNTMTQS
LITPENYEDCYLLGHSMGGAIATQYVECFSHPYSALVLSAPMHGIYMKPWLKPIASPVSH
YLSQWSALPSYALGQSPYQAKPFLDNPLTTSEIRYQWFRDLYQAFPELQIGGPSNHWVNQ
GIKGAKRCIAQAPACTIPTLLMQGEKDKIVDNKSHLKFQKKAPNCQLITIKEAKHELLFE
SDACRNQALLETFAFFEAHSKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacctgaacttactcaagaaccacaataccatgataccatgaaatacaacgta
gctccattttgggagaagcgtcaacatggatttctacaaggtgaaaaaaccactcaacta
cactgggtaagtttcacaagtccaagtcataagaaagcgatcatggtggttaatggtcgt
attgagagtgtgtataaataccaagaactcttttatgatttattttgccaaggctatgac
atttattcatttgatcatcgtgggcaaggcttatccgatcgtttaacagacaatatcgac
attggccacattgaagattttaatgattacattcttgatctcaacaccatgactcaatca
ttgattacacccgagaattatgaagactgctaccttcttggtcactcaatgggaggtgct
attgcaacgcaatacgttgaatgtttttctcacccatactctgcccttgtattaagcgca
ccaatgcacggtatttacatgaaaccgtggttaaagcctatcgcaagccctgttagtcat
tatttaagtcaatggtctgccctgccttcttatgcgttaggtcaatcaccttatcaagca
aaaccgtttttagataatccactaaccaccagtgaaattcgttaccaatggtttagagat
ttatatcaagccttcccggaactgcaaattggtggcccaagtaatcactgggttaatcaa
ggtattaaaggagcaaaacggtgtattgctcaagcacctgcttgcacaataccaacctta
ttaatgcagggtgaaaaagataaaattgtagataacaaatcacacctcaaatttcagaaa
aaagcccctaattgccagctcatcacgattaaagaggcaaagcatgaattattatttgaa
tctgatgcctgcagaaatcaagccttactggaaacattcgctttctttgaggctcattca
aaaaaataa

DBGET integrated database retrieval system