KEGG   Aliivibrio salmonicida: VSAL_I2974Help
Entry
VSAL_I2974        CDS       T00782                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:5.1.2.3)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vsa  Aliivibrio salmonicida
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VSAL_I2974 (fadB)
   01212 Fatty acid metabolism
    VSAL_I2974 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VSAL_I2974 (fadB)
   00650 Butanoate metabolism
    VSAL_I2974 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    VSAL_I2974 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    VSAL_I2974 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VSAL_I2974 (fadB)
   00310 Lysine degradation
    VSAL_I2974 (fadB)
   00380 Tryptophan metabolism
    VSAL_I2974 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VSAL_I2974 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VSAL_I2974 (fadB)
   00281 Geraniol degradation
    VSAL_I2974 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VSAL_I2974 (fadB)
Enzymes [BR:vsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VSAL_I2974 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VSAL_I2974 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VSAL_I2974 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     VSAL_I2974 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3220462..3222642)
Genome map
AA seq 726 aa AA seqDB search
MIYQGENLSVDYIENGIAHLVFNAAGSVNKLNIATLRSLGEAIDVLYKQKDLQALLLSSG
KSAFIVGADITEFLGLFDTPEEELSDWLHQANVIFSRLEDLPVPTLSAITGFALGGGCEC
VLATDFRLADDTASIGLPETQLGIMPGWGGSVRLPRLIGADPAMEVITTGKPKRAKDALK
IGMVDGIVSRETLIDASVSMLKQAIDGQLNWQQRREQKKAPIQLSPLEAAMSFNVAKGMI
MKMAGKHYPAPLTAVKSIEQSANMHRDDALAIENKHFVALTRTDVAKSLVGIFLNDQLVK
SKAKQAVKNSEPVKNAAVLGAGIMGGGIAYQSASKGVPVLMKDIAQASLDLGMNEASKLL
NKQLERGRLSGLKMAQVLSSITPSLNYGGIETKDVIVEAVVENPTIKAAVLAEVENEVNE
HAILASNTSTIPISLLAKSLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSQQTIDRVVAY
ASQMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLRDGGNYQQIDKVMEKEFGWPMGPAYL
LDVVGIDTAHHAQAVMAQGFPERMAKNGRDVIDAMFEDDRYGQKNGIGFYAYALDKKGKP
KKNIDEKTNAIIATITDSTQPYTSEQISARMMIPMINEVIRCLDEGIIASPAEADMALVY
GLGFPPFKGGVFRYLDSIGLDTYLDMAKEFEQLSPVYQVPDSIKQKAAAGECYYPAPKSS
VSSPSV
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaggtgaaaacctctctgtagattacatcgaaaacggcattgctcactta
gtctttaatgcggctggcagtgttaataaactcaatattgctaccctacgctcactaggt
gaagccattgatgttctctataagcaaaaggatttacaagcactgttactttcatcaggt
aaaagtgctttcattgttggtgctgacattacggagttcttagggttgtttgatacacca
gaagaagaactcagtgattggctgcatcaagctaatgtgatttttagccgactggaagat
cttcctgtaccgacattatctgcaattactggctttgctctgggcggtggttgtgaatgt
gtacttgctacggattttcgattggcggatgacaccgcgtcgattggcctaccagaaacc
caactaggtataatgcctggctggggcggttctgttcgtttacctcgcttaattggtgcc
gatcccgcaatggaagtcatcacaacaggtaaaccaaaacgcgctaaagatgcattaaaa
ataggaatggtcgacggtattgtttcacgtgaaacattgattgatgcctcagtatctatg
ctaaaacaagcgatcgatggtcaactaaattggcaacaacgtcgtgaacaaaagaaagcc
cctattcagttatcccctctagaagcggctatgtcgttcaatgtcgccaaaggcatgata
atgaaaatggctgggaaacattatcctgcaccactaactgccgttaaatctatcgagcaa
agtgcaaacatgcatcgtgatgacgctttggcgattgagaacaaacacttcgtggctctc
actcgtactgacgtcgcgaaatcattggttggtattttcttaaatgaccaattagtaaaa
agcaaagcaaagcaagccgtcaaaaacagcgagccagttaaaaatgccgcggtactcggc
gcagggatcatgggcggtggtatagcttatcaatcggcatcaaaaggcgtgcctgtctta
atgaaagacattgcacaagcgtcattagatttagggatgaacgaagcctcgaaactgctt
aataagcaattagagcgcgggcgattatctggactaaaaatggcacaagtactttcatct
atcacaccatcactcaattatggtggcatagagacaaaagacgttatcgttgaagccgtc
gtcgaaaacccaaccatcaaagcagcggtattagctgaagtagaaaatgaagttaatgaa
cacgccatcttagcgtcgaatacctcaactattccaatttcactgctcgctaaatcatta
aaacgtcctgaaaacttctgtggtatgcatttctttaaccctgttcatagaatgccatta
gtggaagttattcgtggcgagaaaacctcacaacaaaccattgatcgcgtagtggcttat
gcttctcaaatgggcaaaacacccatcgttgtgaatgattgtccagggttctttgtgaac
cgtgttctttttccttattttgctggctttagtttattactgcgtgatggcgggaattac
caacaaatcgataaagtgatggaaaaagaatttggctggccaatgggccctgcttatttg
ctagatgtcgtggggattgataccgcccatcatgcacaagcggtgatggcgcaaggtttc
cctgaacgcatggcgaaaaatggccgagatgttatcgatgcgatgtttgaagatgatcgc
tatggccaaaaaaatggaattggcttctatgcttatgcccttgataaaaaaggcaagccg
aagaaaaacattgatgaaaaaaccaatgcaattatcgcaacaataaccgattcaactcaa
ccttacacctctgagcaaattagcgctcgtatgatgatcccaatgattaacgaagtcatt
cgttgtttagatgagggtattatcgcttctccagcagaggctgacatggccttagtgtat
gggttaggttttcctccatttaaaggcggcgtattccgctacctggattctatcggtcta
gacacgtatttagacatggccaaagagtttgagcaattaagtccggtttaccaagtgcct
gacagcatcaaacaaaaagcagcggctggagagtgttattacccagccccgaaatcatct
gtttcatcaccatcggtttaa

DBGET integrated database retrieval system