KEGG   Aliivibrio salmonicida LFI1238: VSAL_II0285Help
Entry
VSAL_II0285       CDS       T00782                                 

Definition
arylesterase precursor (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vsa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(317556..318176)
Genome map
AA seq 206 aa AA seqDB search
MTMRRFFTFSFLLISSVLLPFKNAYSQTLLILGDSLSAGYNMPIEQSWPSLLPTQLATLN
KDTTVINGSISGDTTGNGLDRLPALLTQHSPDIVLIELGANDGLRGFPPQKINSNLEQLI
KLINASNAQPLLMQIQVPPNYGKRYSQAFGSLYPKISEKHDIPLVPFFLEHVIIKPEWIM
KDGLHPTPEAQPWIAEFMAKELSPYL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcgccgtttttttacgttctctttcttacttatatccagcgttttgctgcct
tttaaaaacgcctatagccaaacgttattgattttaggcgacagcttgagcgccggttat
aatatgccgattgagcaaagttggccttcattattaccaacacaattagccactttaaat
aaagacacgacggtaattaatggcagtatctctggcgatacgacgggcaatggattagat
cgacttcccgcgttattaacgcaacatagccctgatatcgtattaattgaattaggtgca
aacgatggcttacgtggttttccgccacaaaaaattaattcaaatctagagcaattaatt
aaactgattaacgcctcaaatgcccaaccgttattaatgcaaatccaagtaccgcctaac
tatggtaaacgttatagccaagcgtttggttcactttatcctaagatcagtgaaaaacat
gacattcctttggttccttttttcttagagcatgtcatcattaagccagagtggataatg
aaagacggcttacacccaacgccagaggctcaaccttggattgctgaattcatggcaaaa
gaattatccccttacttataa

DBGET integrated database retrieval system