KEGG   Aliivibrio salmonicida LFI1238: VSAL_II0394Help
Entry
VSAL_II0394       CDS       T00782                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vsa  Aliivibrio salmonicida LFI1238
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(439492..440547)
Genome map
AA seq 351 aa AA seqDB search
MYIHKESTVQFLPLRWIIPLIIISVCSIYLYFSFQEPIWDLDTQPQPPKSNEFFSNAITV
INKVEIKEKSKAKLGLELFLDPRLSSNGQVSCESCHHIFTNGAESIPASIGVHGEGTRNS
PTLFNISLNTRFFWDGRAASLEQQLDGPIHNPLEMDSNWTDIIQFLTSSDHYSNRFKQEY
NGDITEATVKDALVTFMATLNTPDAPFDHYLKGDKRAISQIAVNGWDKFQQLGCVFCHQG
QNVGGNLFQKFGNLAALETQFGDSANNDLGRFDITGDINDRHVFRVPSLRNVAITAPYFH
HGKTETLEEAIIIMARVQLGQELTPMTVVEISAFLNTLTAPRPAALEELIQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgtatatacacaaggaatcaaccgtgcaatttttaccattacgttggattattccactt
atcattattagcgtttgtagtatttacttatatttctcttttcaagagcctatttgggat
cttgatactcaacctcaaccccccaaaagtaatgagtttttttctaacgctatcactgtt
atcaataaggttgaaattaaagaaaaaagcaaagctaaattaggcttagaactctttctt
gacccaagattgtcctctaacgggcaagtgagttgcgaatcttgccaccacatatttacg
aatggtgctgaatctattcccgcttctattggtgttcatggcgaaggtactcgtaattcc
cccaccttattcaatatcagtttaaacacccgtttcttttgggatggacgcgcagcgagt
ctagaacaacaacttgatggccctattcacaatccattagaaatggacagcaattggact
gacatcattcaatttcttacctcttcagatcactactccaatcgtttcaaacaggaatac
aatggagacatcacagaagccacagtcaaagacgctttagtcacttttatggcaaccctt
aatacaccagatgcaccgtttgatcactatttaaagggcgacaaaagagccatatcccaa
atagccgtcaatggctgggataaattccaacaactggggtgtgtattttgtcaccaagga
cagaatgtaggaggaaacttgtttcagaagtttggtaatttagccgcattagaaacacaa
tttggtgactctgcaaacaacgatcttggacgatttgatatcacaggagacatcaatgac
cgtcatgtttttcgtgtccctagcttgcgaaatgttgctattactgcaccttatttccat
catggaaaaacagaaacccttgaagaagccattatcattatggcgagggtgcaattagga
caagagcttacccccatgaccgttgtcgagatcagtgcattcttaaacaccttaacggca
ccaagacctgctgcgttagaggagttaatccaatga

DBGET integrated database retrieval system