KEGG   Aliivibrio salmonicida LFI1238: VSAL_II0424Help
Entry
VSAL_II0424       CDS       T00782                                 

Definition
putative fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vsa01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vsa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(476655..477782)
Genome map
AA seq 375 aa AA seqDB search
MNKGSKPPIIWLNVFIFTSSLLLALVATPIYAYYNGLGTEHWIWLLLTFSFCNLSITAGY
HRLWSHKAYNAHPALRFIFALGGAFALQNSALHWSSDHRVHHRHVDDNDKDPYSAKRGFW
FSHIGWMLRHYKPAKFDDYSNCRDLQKDKIVMWQHNHYVPLALVMNLGVPLLLGVIYGDI
LGMLLMIGAVRLVLNHHTTFFINSLAHIWGSQPYTEKNTARDNGILAVLTFGEGYHNYHH
IFENDYRNGIYWWQYDPTKWLIKSCSWLGLTSKLRISPQAKVEKAQALMLRKKAEDKIAK
LHNYHAVKEHLEAEYEALIERMSEYYDSKKQLLEHKKNALSKQYEIAVLNVQHKQIKMQF
EQQKKAWNRLVLQYV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggatctaaaccaccaattatttggttgaatgtatttatttttacatcaagt
ctgttacttgctttagttgcaacccctatttatgcctattataacggcctaggtactgag
cactggatatggctgctgctaacttttagcttttgtaatctttctataacagctggctat
catcgtttatggtctcataaagcttataatgctcatcctgcattacgtttcatttttgct
ttagggggcgcctttgccctacaaaatagtgccttacattggtcatctgatcatagagtt
catcatcgtcatgtagatgataatgataaagacccttattcagcaaagcgcggattttgg
ttttcacatataggctggatgctacgtcattataaaccagctaaatttgatgattattca
aactgccgtgatttacaaaaagataaaatagtcatgtggcaacataatcattatgttccc
cttgctttagtcatgaatctaggtgtaccactgcttcttggtgttatttatggcgacatc
cttggcatgcttttaatgataggtgcagtacgtttagtattaaaccaccacacgactttt
ttcattaattcactcgctcatatctggggtagccaaccttatacagagaaaaataccgct
cgtgataatggtattttagcggtcctgacttttggggaaggttatcataactaccaccac
atattcgaaaatgactatagaaatggcatttattggtggcaatatgatccaactaaatgg
ttaattaaaagctgctcttggttaggattaacaagcaaacttcgcattagccctcaagct
aaagtagaaaaagcacaagcgttaatgttacgaaaaaaagcagaagataaaattgcaaag
cttcataattatcatgccgtaaaagagcatttagaggccgagtacgaagccctgattgaa
cgcatgtctgaatactatgattcaaaaaagcaattacttgaacataagaaaaatgcatta
tcaaaacaatatgaaatcgcggttctaaacgttcaacataagcaaattaaaatgcagttt
gaacaacagaaaaaagcatggaaccgcctagtgcttcaatatgtttaa

DBGET integrated database retrieval system