KEGG   Aliivibrio salmonicida: VSAL_II0575Help
Entry
VSAL_II0575       CDS       T00782                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vsa  Aliivibrio salmonicida
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VSAL_II0575 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VSAL_II0575 (nagZ)
Enzymes [BR:vsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VSAL_II0575 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:628857..629852
Genome map
AA seq 331 aa AA seqDB search
MGPLWLDVEGYEIDAEERELLQHPTVGGLILFARNYHDPAQLSALIASIRKATGRPIIIG
VDQEGGRVQRFRDEFTLIPPAQAYAEMNNGIELAKTAGWLLCAELVAHDIDLTFAPVLDS
GFDCKAIGNRAFGDDINTIVKYSTAFMQGMKSAGTSTTGKHFPGHGGVIADSHLETPYDN
RDNIVELDMAIFKAQIDAGILDAMMPAHVIYPEYDSSPASGSSFWLKDILRKQLNFTGLV
FSDDLSMEGATIMGGPAERSQQALEAGCDMLLMCNNRKSAVEVLDNLAIQTVEKAHSLLK
TQSFDRKTLRSSKEWKAANETITRAYDGWKS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgttatggctagatgttgaagggtatgaaattgatgcagaagagcgtgagcta
cttcagcatcctactgtgggtggtttaatcctttttgctcgtaattatcacgatcctgca
cagttgtcagcgctcatcgcgtcaattcgtaaagcgacaggtcgccctattattattggt
gttgaccaagaaggtgggcgtgttcaacgtttcagagatgaatttaccttaatcccaccc
gctcaagcgtatgccgagatgaacaatggtatcgagttagcgaaaacagcgggttggcta
ttgtgtgctgaattagtcgctcatgacatcgatttaacgtttgcaccagtgttagacagc
ggctttgattgtaaagcgattggtaatcgtgcatttggcgatgatattaataccattgtt
aagtacagcaccgcctttatgcaaggaatgaaatcggcaggaacgtcgacaacgggcaag
cattttcctggccacggtggtgtgattgccgattctcatttagaaaccccttatgataat
cgcgacaacattgttgagctagacatggccatctttaaagcacaaattgatgccggtatt
ttagatgcgatgatgccagcacatgtgatttaccctgaatacgattcatcaccagccagt
ggttcatcattctggttaaaagacatcttacgtaaacaactcaactttactggtttggtg
ttttctgatgaccttagtatggaaggggcaacgataatgggggggcctgcagaacgttct
cagcaagcattagaggccggttgcgatatgctcttaatgtgtaataacagaaaatcagcg
gttgaagtgttagataatctcgcgattcaaaccgtagagaaagctcattcgttgttaaaa
acacaaagctttgatcgaaaaacactgagaagcagcaaagagtggaaagccgcaaacgag
acgattactcgtgcttatgatggctggaagtcttaa

DBGET integrated database retrieval system