KEGG   Vibrio scophthalmi: VSVS12_01478Help
Entry
VSVS12_01478      CDS       T04650                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vsc  Vibrio scophthalmi
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:vsc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VSVS12_01478 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    VSVS12_01478 (atoB)
   00640 Propanoate metabolism
    VSVS12_01478 (atoB)
   00650 Butanoate metabolism
    VSVS12_01478 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    VSVS12_01478 (atoB)
   00072 Synthesis and degradation of ketone bodies
    VSVS12_01478 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VSVS12_01478 (atoB)
   00310 Lysine degradation
    VSVS12_01478 (atoB)
   00380 Tryptophan metabolism
    VSVS12_01478 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VSVS12_01478 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VSVS12_01478 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VSVS12_01478 (atoB)
Enzymes [BR:vsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VSVS12_01478 (atoB)
Exosome [BR:vsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VSVS12_01478 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1580100..1581305
Genome map
AA seq 401 aa AA seqDB search
MSKVYIVGAKRTALGAFGGSLSLVPAFELGGHAIKAALEQASVSPDLLDEVIVGNVLTAG
QGMGPGRQAAKFADVPDSVPAYTLNMICGSGMKTVMEAATKIKAGDADLVVAAGMENMSS
TPYLVSAQNRFGSKMGNQQLVDTMIHDGLTDAFNSYHMGMTAENVAEKYQINRDSQDAFA
LRSQQRAVAAIEQGRFVDEIVPVEVHQRRTTSLFTQDEYPRADASLESLGKLRPAFKKEG
SVTAGNASGINDGGVAFVVASEKAVKEHGLKPLAEIVSYGQGGLDPAFMGLGPVPAIEQA
LERANMTLADVQLLELNEAFAAQALGVMHGLSEKYDLPLDWFDDKTNVNGGAIALGHPLG
ASGGRILTTLIYEMEKREVQFGLASLCIGGGMGTAVLIKKI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtttatattgtaggtgcaaaacgcacagctttaggcgcatttggcggctct
ttatcattagtgcctgcgtttgaattaggcggccatgccatcaaggcggctttagaacaa
gcgagcgtctctcctgatttactggatgaagtgattgtcggtaatgtgctaaccgcaggc
caaggtatggggccggggcgtcaggctgcaaaattcgctgatgtgccagattcggtgcct
gcttatacgctcaatatgatttgcggtagtggcatgaaaaccgtgatggaagcggcgacg
aagatcaaagcaggcgatgcagaccttgttgtggcggctggcatggaaaacatgtcaagt
acgccatatttggttagtgcgcagaaccgattcggcagtaaaatgggcaatcaacagttg
gttgataccatgatccatgatggtttaacggatgcgttcaatagttatcacatggggatg
actgcggaaaacgtcgctgaaaaataccaaattaatcgtgacagccaagatgcttttgct
ttgcgtagccagcaacgcgccgttgccgcgattgaacaagggcgttttgtcgatgaaatc
gtgccagtggaagtgcatcagcgccgcaccacctcactgtttacgcaagatgaataccca
cgcgcagacgcatcacttgagagccttggcaagctcagacctgcctttaagaaagagggt
tctgtcactgcgggtaatgcttcgggtatcaatgacggtggggttgcgtttgtcgtcgcc
tctgaaaaagcggtcaaagaacatggcttaaaaccactggctgaaattgtcagttacggt
cagggtggtttagatcctgcctttatggggttagggcctgtaccggcaattgaacaagcc
ttggaaagagcgaacatgacgctagctgatgtgcagttgctagagctcaatgaagcgttt
gccgcgcaagctttaggtgtgatgcacggcctaagtgaaaaatatgaccttccattagat
tggttcgatgataagaccaatgttaacggcggtgcgattgcactaggtcatccacttggc
gcatctggtggccgtatattgacgacactgatttatgaaatggagaagagagaagttcaa
tttggcctggcttcactctgtattggcggtgggatgggaaccgctgtccttatcaaaaag
atctga

DBGET integrated database retrieval system