KEGG   Vibrio scophthalmi: VSVS12_03820Help
Entry
VSVS12_03820      CDS       T04650                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vsc  Vibrio scophthalmi
Pathway
vsc00071  Fatty acid degradation
vsc00280  Valine, leucine and isoleucine degradation
vsc00310  Lysine degradation
vsc00362  Benzoate degradation
vsc00380  Tryptophan metabolism
vsc00620  Pyruvate metabolism
vsc00630  Glyoxylate and dicarboxylate metabolism
vsc00640  Propanoate metabolism
vsc00650  Butanoate metabolism
vsc00900  Terpenoid backbone biosynthesis
vsc01100  Metabolic pathways
vsc01110  Biosynthesis of secondary metabolites
vsc01120  Microbial metabolism in diverse environments
vsc01130  Biosynthesis of antibiotics
vsc01200  Carbon metabolism
vsc01212  Fatty acid metabolism
vsc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vsc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VSVS12_03820
   00630 Glyoxylate and dicarboxylate metabolism
    VSVS12_03820
   00640 Propanoate metabolism
    VSVS12_03820
   00650 Butanoate metabolism
    VSVS12_03820
  Lipid metabolism
   00071 Fatty acid degradation
    VSVS12_03820
   00072 Synthesis and degradation of ketone bodies
    VSVS12_03820
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VSVS12_03820
   00310 Lysine degradation
    VSVS12_03820
   00380 Tryptophan metabolism
    VSVS12_03820
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VSVS12_03820
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VSVS12_03820
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VSVS12_03820
Enzymes [BR:vsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VSVS12_03820
Exosome [BR:vsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VSVS12_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Chon_Sulph_att
Motif
Other DBs
NCBI-ProteinID: ANS87520
UniProt: A0A1B1NUX8
Position
2:892127..893341
Genome map
AA seq 404 aa AA seqDB search
MEKVYIVAAKRTAIGSFGGALKNTDAGNLAAVAIKAALEQSQINNEFIDEVIVGNVIGAG
QGMSVGRQAAMYAGIPETTPAYTLNMVCGSGMKTVMDAISHIRSGDGDIIVAAGVEVMSQ
IPFIVPSQIRDGHKMGNMALTDLLINDGLTDVFNQYHMGVTAENVAKEVGITREQQDQYA
LASQMKAVAAIEGGNFKAEIAPVEVKVRRETLVFDTDEYPKANATLESLQKLRPAFDKEG
SVTAGNASGLNDGASAVILASESAVKQHNLKPLAEVVSYAQAGLDPKIMGLGPVPAVTKA
LTKAELATDDIDCYELNEAFAAQALGVIHRLAEEHNVPVNSILDKANPNGGAIALGHPLG
ASGNRILVSLIHELNRSNGQYGVASLCVGGGMGTAVIVKSIKWN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtctatatcgttgcggcaaaacgtaccgcaattggctctttcggtggggcg
ctaaaaaacaccgatgcgggaaatcttgctgcagtagcgattaaagcagcactggaacag
agccagattaataatgaattcatcgatgaagttatcgtcggtaacgttattggtgcaggc
cagggcatgagtgttggtcgccaagccgctatgtatgcaggcattcctgaaacgacgcct
gcatacaccctaaacatggtgtgtgggagtggcatgaaaaccgtgatggatgcgatcagc
catattcgctctggggatggtgacatcatcgtcgccgctggagttgaagtgatgtctcaa
atcccattcatcgtgccaagccaaatccgagatggtcataagatgggaaatatggctctg
acggatttgcttattaacgatggcctcacggatgtgtttaatcaatatcatatgggtgtg
acggcagaaaatgtcgccaaagaagtcggtattacgcgtgagcagcaagatcaatatgcc
ttggccagtcagatgaaggcggttgcggcgattgaaggtgggaactttaaagcagagatc
gcaccggttgaagtcaaggttcgtcgtgagacgctagtattcgatactgatgaatatccg
aaagcaaacgcgacgctagagagtttacaaaaactcagacctgcttttgataaagaaggt
tcggttacagcgggcaatgcgtcgggtcttaatgatggtgcgagtgcagtgattcttgcg
agtgaaagtgctgttaagcaacacaacctaaagcctctagctgaagtcgtcagctatgct
caagccggcttagatccaaaaattatgggcttaggccctgttcccgcagtcacaaaagct
cttaccaaggcagagttagcgacagatgacattgattgctatgaattgaacgaagccttt
gctgcgcaagctttgggggttattcatcgccttgccgaagagcataacgtcccggtcaac
agcatccttgacaaagcaaatcctaatggtggcgctattgcgcttggtcatcctttgggg
gcatcgggcaatcgaattttagtatcactgattcatgaattaaatcgaagtaacggccag
tatggcgttgcatctctatgtgttggcggaggtatgggtaccgctgtcatcgttaaatca
atcaaatggaattaa

DBGET integrated database retrieval system