KEGG   Vibrio tasmaniensis: VS_0041Help
Entry
VS_0041           CDS       T00812                                 

Definition
(GenBank) Fatty oxidation complex, alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00071  Fatty acid degradation
vsp00280  Valine, leucine and isoleucine degradation
vsp00281  Geraniol degradation
vsp00310  Lysine degradation
vsp00362  Benzoate degradation
vsp00380  Tryptophan metabolism
vsp00410  beta-Alanine metabolism
vsp00640  Propanoate metabolism
vsp00650  Butanoate metabolism
vsp00903  Limonene and pinene degradation
vsp00930  Caprolactam degradation
vsp01040  Biosynthesis of unsaturated fatty acids
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
vsp01130  Biosynthesis of antibiotics
vsp01200  Carbon metabolism
vsp01212  Fatty acid metabolism
Module
vsp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VS_0041
   00650 Butanoate metabolism
    VS_0041
  Lipid metabolism
   00071 Fatty acid degradation
    VS_0041
   01040 Biosynthesis of unsaturated fatty acids
    VS_0041
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VS_0041
   00310 Lysine degradation
    VS_0041
   00380 Tryptophan metabolism
    VS_0041
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VS_0041
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VS_0041
   00281 Geraniol degradation
    VS_0041
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VS_0041
   00930 Caprolactam degradation
    VS_0041
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VS_0041
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VS_0041
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VS_0041
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VS_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAV17097
UniProt: B7VGL4
Position
1:complement(38691..40862)
Genome map
AA seq 723 aa AA seqDB search
MIYQANTLQVKELQDGIAELSFCAPASVNKLDLATLESLDKALDALNAHAGLRGLILTSN
KDAFIVGADITEFLGLFAKPEAELDEWLRFANSIFSKLEDLPVPTLSMMRGHALGGGCEC
VLATDFRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRADEALK
VGLLDAIVETDQLLESAINTVSLAANEKLDWQLRRKQKTSALSLSKLEAMMSFTMAKGLV
AQKAGPHYPAPITSVIAIEEAARSDRDAALDIERKHFVKLAKSEEAKALVGLFLNDQYIK
GLAKHAGKSANKATERAAVLGAGIMGGGIAYQSALKGVPVMMKDIAQASLELGMNEASKL
LNKRLSRGRLDGFKMAGILSSITPSLHYAGVEQSDVIVEAVVENPKVKAAVLSEVEGLVG
EDTVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSEETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKIDKVMERKFGWPMGPAY
LLDVVGLDTAHHAQAVMAQGFPERMGKEGRDAIDALYVAEKYGQKNGSGFYTYSVDKRGR
PKKTFSEDILPILADVCQQPQDFDDQTIIQRVMIPMINEVVLCLEEGIIATPQEADMALV
YGLGFPPFRGGVFRYLDSVGIGNFVEMAKSYQDLGAMYQVPQLLLDMAAKGESFYDGQQA
SSL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagctaacaccttacaggtaaaggaattacaagatggtattgcagaactt
agcttctgtgctccggcctctgtaaacaaactcgaccttgctactttagaatcactagac
aaagcgttagatgctcttaatgctcacgctggattacgtggtttaatcttaacttcaaac
aaagacgcgttcatcgtaggcgcagacatcactgaatttcttggcctatttgctaagcca
gaagcagaacttgatgaatggttaagattcgctaattcaatcttcagcaagctcgaagac
cttcctgtcccaactctttcaatgatgcgtggccatgcccttggtggcggctgtgaatgt
gtcttagcgaccgatttccgtatcggtgacaagaccaccagcattggcctacctgaaacc
aaacttggcatcatgcctggttttggtggttgtgtgcgcctacctcgtgttatcggtgct
gacagcgcaatggaaattatcacacaaggcaaagcatgccgtgcagatgaagcgcttaaa
gttggcttgttagatgcgattgttgaaacagaccagttactagaatcggcgatcaacacc
gtttctctggctgctaatgaaaaattagactggcaattacgccgcaaacaaaaaacatca
gcattatcgctaagcaaactcgaagcgatgatgagctttaccatggcgaagggcttagtt
gctcaaaaagcagggcctcactacccagctccgattacttctgtgattgcgattgaagaa
gcagcacgcagcgatcgcgatgcagcactcgacatcgaacgtaaacacttcgttaagcta
gcaaaatctgaagaagcgaaagctctggttggcctgttcttaaatgaccaatacattaaa
ggcttagcaaaacatgctggtaaatctgcaaataaagcgactgaacgtgctgcagtactt
ggtgctggcatcatgggcggcggtattgcttaccagtcagcattgaagggcgtgccagtg
atgatgaaagacatcgcacaggcgtctcttgagcttggtatgaacgaagcttctaagctg
ttgaataaacgcttatcgcgcgggcgcctagatggattcaagatggcaggcattctgtct
tctattactccaagtctgcattatgcaggtgttgaacaatctgatgtgattgtggaagcc
gttgtagaaaaccctaaagtaaaagcagcagtgctgagtgaagttgaaggtctcgtgggt
gaagatacagttcttacatcaaacacctcaacgattccaatcaacctgttagcgaaatct
ctaaaacgcccagaaaacttctgtggcatgcacttctttaacccagtgcatcgcatgcca
ttggttgagatcatccgtggcgagcatacttcagaagagaccattaatcgcgtggttgct
tacgcagcgaagatgggcaaatcaccaatcgttgttaacgactgcccaggcttcttcgtt
aaccgtgtactttttccttactttggcggtttcagcatgttgctacgcgacggtgctgac
ttcacgaagatcgataaagtgatggaacgtaagttcggttggccaatgggcccagcttac
ttgctagacgttgtaggtttagacacagcacatcatgcacaagcagtaatggcgcaaggt
ttcccagagcgtatgggtaaagaaggccgtgatgcaattgacgcactttacgtcgctgaa
aaatacggccagaagaacggcagcggtttctacacgtacagcgtagacaaacgtggtcgc
ccgaagaaaaccttctctgaagacattcttcctatcttggctgacgtatgccaacagccg
caagactttgatgaccagacaattatccaacgtgtgatgattcctatgatcaacgaagtg
gtgctttgtttagaagaaggcattatcgcgacaccgcaagaagcggatatggcactggtt
tacggtttaggcttccctccattcagaggcggcgtattccgctacttagacagtgtgggt
attggtaacttcgttgaaatggcgaagagctaccaagacttaggtgcaatgtaccaagtt
cctcaactattgcttgatatggcagcgaagggcgaaagcttttacgacggtcaacaagcc
agttctctgtaa

DBGET integrated database retrieval system