KEGG   Vibrio tasmaniensis: VS_0161Help
Entry
VS_0161           CDS       T00812                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00230  Purine metabolism
vsp01100  Metabolic pathways
Module
vsp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VS_0161
Enzymes [BR:vsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VS_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 ABC_tran RsgA_GTPase AAA_22 MMR_HSR1 AAA_29
Motif
Other DBs
NCBI-ProteinID: CAV17193
UniProt: B7VHI1
Position
1:complement(156242..156865)
Genome map
AA seq 207 aa AA seqDB search
MGKGTLYIVSAPSGAGKSSLISAMLETNPTYAMKVSVSHTTRGMRPGEENGVHYHFVEKH
HFEDLINKGEFLEYAEVFGNYYGTSRVWIEENLDRGIDVFLDIDWQGARQIREQMPQAKS
VFILPPSNGELERRLNVRGQDSDEVIAKRMSEAKSEISHYAEYDYVIVNDDFDAALMDFR
AIIRAERLKEDKQAAKYSGMLTALLAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggtactctttacatcgtatctgcacctagtggcgcaggtaagtcgagcttg
atctcagcaatgctagaaaccaatccaacctacgcaatgaaggtatctgtttcacacacc
actcgcggtatgcgccctggtgaagaaaatggtgttcactaccacttcgtagagaagcat
cattttgaagaccttattaataaaggtgaattcctagagtacgctgaagttttcggcaac
tactacggtacttcacgcgtttggattgaagaaaacctagaccgcggtatcgatgtattc
ctagatatcgactggcaaggtgctcgtcagatccgtgaacaaatgcctcaagcgaagagt
gtattcattcttccaccatcaaatggtgagctagagcgtcgtttgaatgttcgcggccaa
gacagcgacgaagttattgcgaaacgcatgagcgaagcaaaatcagaaatttctcactat
gcagaatacgattatgtgatcgtgaatgatgactttgatgcagccctaatggacttcaga
gctatcattcgtgcggagcgcttaaaagaagataagcaagcagcgaaatacagcggcatg
cttacagcactactagcggaataa

DBGET integrated database retrieval system