KEGG   Vibrio splendidus: VS_0166Help
Entry
VS_0166           CDS       T00812                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vsp  Vibrio splendidus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VS_0166
  Amino acid metabolism
   00300 Lysine biosynthesis
    VS_0166
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     VS_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(162510..163940)
Genome map
AA seq 476 aa AA seqDB search
MTESNFSAQTLRYFDSNIETFTRDLSELIAIPSVRDISSCSPNAPFGLPIRNAFDFLINW
AKREGFEVRDHDGYALDISFGEGLQEIGILHHVDVVEAGNLDSWLTPAFEMHQHGDDLLG
RGVTDNKGPLMASLYILKMFKALDVTLDKKIRVIIGGAEETTWECVEHYFNHNPQPDYGF
SPDGDFPIVNGEKGILYASLQREFPTHNGLGTCQIVSIESERDRTSTCYQLSIYLTGEKA
AEVAATFETSATVTLANVAQSDNHQQKELYCVELSTPWEKSRNPHKVDNCMDQFVRQMRH
VEGLDTNSRNLIDLLDACFSDSNDASKLGLAHQDNEMGSTTCCVSSINLNQHGYNLDFDF
RFPKGLTIDQARTQLQYVSQQYGVRLIEHQYLPLSYLSPESELIQAMGKAYSEVTKMDAQ
CFSKGAASYARALNNGVAFGPTFPGDVTRVHEPNERLSLESLKRAITIYVKVLISL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaagcaatttttcagctcaaacactgcgctattttgattcaaatattgaaacg
tttacgcgtgatctatctgagctaattgctattccgtctgtacgagatatcagcagctgt
tcacccaatgctccttttggtttaccgattagaaacgcattcgactttctcattaactgg
gcgaaacgagaagggtttgaagtccgtgatcatgatggttatgccttggacatcagcttt
ggcgaaggcttacaagaaatcggcatattgcatcatgtagatgtggtagaagccggtaat
ttggactcatggttaacccctgcatttgagatgcaccaacacggtgatgacttattgggg
cgaggcgttaccgacaacaaaggcccgttaatggccagtctgtatattctcaagatgttt
aaagcgcttgatgtaacactcgacaaaaaaataagagtgatcatcggcggcgcagaagag
acaacttgggaatgtgtagagcattattttaatcataaccctcaaccggattatggtttc
tctccagatggcgacttcccaatcgttaatggagaaaaaggcatcctatatgcgtcattg
caacgagaattcccaactcacaatggcctaggaacttgtcagatcgtaagcattgaaagt
gagcgtgacagaacatccacctgctatcaattatcgatttatctgacaggagaaaaagcg
gctgaagtagcagcaacatttgaaacttcagcaacagtcactcttgccaatgtggcacaa
agtgacaaccaccaacaaaaggagttgtactgcgttgagttgtcaacgccgtgggagaaa
tctcgcaacccgcataaggtcgataactgtatggatcagtttgttcgtcaaatgcgacat
gttgaagggttagacactaactctcgaaatttaattgatttactagacgcgtgttttagt
gattccaatgatgcttcgaaattaggactagcacaccaagataatgaaatggggtcgact
acatgctgtgtctcctccatcaatttgaatcaacatggctacaacttggattttgatttt
cggtttcctaaaggactgactatcgatcaagctcgtacccaactccagtatgtatcccaa
caatacggagtgagattgattgaacaccagtacttacctctatcttacctctcacccgaa
agtgaacttatccaagcaatgggaaaagcttattccgaagttaccaaaatggacgctcaa
tgctttagcaaaggtgcagcttcttacgcgcgcgcgctaaacaatggtgtggcattcgga
cctacttttcctggtgatgtgactcgtgtccatgagcccaatgaaaggctcagcctcgag
tcattaaaaagagcaataacaatatacgtgaaagttctcatatcactttag

  All links  
No link information was found.   
DBGET integrated database retrieval system