KEGG   Vibrio tasmaniensis: VS_0321Help
Entry
VS_0321           CDS       T00812                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00040  Pentose and glucuronate interconversions
vsp00052  Galactose metabolism
vsp00500  Starch and sucrose metabolism
vsp00520  Amino sugar and nucleotide sugar metabolism
vsp01100  Metabolic pathways
vsp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VS_0321
   00052 Galactose metabolism
    VS_0321
   00500 Starch and sucrose metabolism
    VS_0321
   00520 Amino sugar and nucleotide sugar metabolism
    VS_0321
Enzymes [BR:vsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VS_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: CAV17330
UniProt: B7VI93
Position
1:complement(314505..315377)
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMDGMCIVTGRGKH
SLMDHFDKNYELEHQISGTNKEDLLTNIRETIEAANFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEQQGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVISGEMIKDD
LFRVDDMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAKSG
CVLAYKFKGQRFDCGSVEGYIEATNYCFENLYKKDQQQIELGKHSTTKEA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagtgccttttcccggcagcaggctacggtacacgttttttaccagcaact
aagtcaatgccgaaagaaatgatgcctgtagtaaacaaacctctgattgaatacggcgtt
gaagaagctatcgaagccggtatggatggaatgtgcatcgttaccggtcgtggtaagcat
tctctgatggatcactttgataaaaactacgagctcgaacatcagatcagcggcaccaat
aaagaagacttactgaccaatatccgtgaaaccattgaagcggcaaacttcacttacatt
cgccaacgtgaaatgaaaggtctaggtcacgctatcttgacgggtcgtgagcttgtgggt
gatgaaccattcgcagttgtgcttgctgatgacctttgtgtgaacgaacagcaaggtgta
ctggctcaaatggttgctttatacaagcaattccgctgttcaatcgttgctgtacaggaa
gtacctgaaaacgaaacacacaaatacggtgttatctctggcgaaatgatcaaagatgac
cttttccgtgttgatgacatggtagaaaaaccagaaccaggcactgcgccaagtaaccta
gcaatcattggccgttacattctgactccagatatctttgagcttatcgagcagactgaa
ccaggcaaaggcggtgaaatccagatcactgatgcattgctgaaacaagcaaaatcaggt
tgtgtattggcttacaaatttaaaggtcaacgttttgactgcggtagtgttgaaggctac
atcgaagcaacaaattactgctttgaaaacctatacaaaaaagaccagcaacaaatcgag
ctaggtaagcactcaacaacaaaagaagcttaa

DBGET integrated database retrieval system