KEGG   Vibrio splendidus: VS_0405Help
Entry
VS_0405           CDS       T00812                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vsp  Vibrio splendidus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vsp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:410724..411206
Genome map
AA seq 160 aa AA seqDB search
MTIAYVGVGTNIDRDKHARVAWTELQSLGTNLKCSKIYHCEPVGFKSHSFYNFVVEIDTS
LSLTEFSQHLREIEFKWGRPQDAHKLQDRKLDLDIVLFGEVVSESDPELPRSDIYKYPFV
TQPLYDLCPARVIPQDGRTVSEIWQKMQQLDTLSVVDITL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagcctatgttggtgttggcacgaacatagaccgcgacaagcatgcaagggtg
gcatggacagagcttcaatcattagggactaaccttaaatgctctaagatctatcactgt
gagcctgtggggtttaaaagccactcgttttataactttgtggttgagatcgatacatca
ctctcattgactgaattttcacagcacctgcgtgaaattgagtttaaatggggtcgccct
caagatgcccataagcttcaagatcgaaagctcgatcttgatattgtgctgtttggagag
gtggtatcagagagcgatccagaattaccacgcagtgatatctataaatatccttttgta
acacaaccactttatgatctttgtcctgcgagagtgatcccgcaagatggaagaaccgtc
agtgaaatatggcagaagatgcagcaattagatacgctctctgtcgttgatataacacta
taa

DBGET integrated database retrieval system