KEGG   Vibrio splendidus: VS_0445Help
Entry
VS_0445           CDS       T00812                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vsp  Vibrio splendidus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vsp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vsp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:454585..456069
Genome map
AA seq 494 aa AA seqDB search
MSNSLTLSSLLSPWGDFSSLELDAIVVEQLELDSRTIKEGDIFVAIVGHAIDGRRFIDKA
VAQGAKAVIAQASDDKAHGLVEWLNAVPVVYVSELNSILSELAGRVYSSQATKLIGVTGT
NGKTTITQLIAQWLDLVGQRSAVMGTTGNGFLDNLKIAANTTGSAIEIQRTLSELAEESA
VYTAMEISSHGLVQGRVKALNFEVGVFTNLSRDHLDYHGTMEEYALAKKSLFTQHKCKHA
VINVDDEVGKAWVSDLSNAIAVSLSPLTGYQQSVWASDVAYAETGIQLSFDGSWGQGKLS
VPLIGQFNASNVLVAFSTLLSLGIDKQILVDTASQLQPVIGRMELFQTPNKAKVVVDYAH
TPDALEKALAALRVHCSGQLWAIFGCGGDRDTGKRPMMAVTAEQFADKIIISDDNPRSED
PALIVKDMLAGLSEPESAFVEHDRYQAVKFALEQAGSNDIILLAGKGHEDYQVLKDETIH
YSDRESALQLLGIS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatagcctcacgctgtcatctttactttctccttggggggactttagttcactt
gagctagatgcgattgttgttgagcaattggagttggatagccgtaccatcaaggaaggc
gatatttttgttgccattgttggacatgccattgatggtcgtcgctttatcgacaaagcc
gtcgctcaaggtgcgaaagctgtcattgcacaagcgagtgatgacaaagctcatggcttg
gttgagtggttaaatgctgttcctgttgtttatgtatctgagctaaattcaattctctct
gaactggctggccgagtttattcttctcaagcgactaagttgattggtgttaccggcacc
aatggtaaaaccaccatcacccaattgattgctcagtggcttgatttggtcggccagcgt
tcggcggtaatgggcacaacgggtaatggcttcttagataacctaaaaatagcggctaat
accacgggcagcgcgattgaaatacaacgcacactgagcgagttggctgaggaaagtgca
gtttataccgcgatggaaatctcttctcatggtttggttcaaggccgagtaaaagcgttg
aattttgaggttggtgtgttcactaacctgagtcgtgatcaccttgattaccacggcacg
atggaagagtacgcactggctaagaagagcctgtttactcaacacaaatgcaagcacgca
gtcattaatgtggatgacgaagtaggtaaagcttgggtgtcagatttatccaatgccata
gccgtttcgctgtcaccgctaacgggctatcaacaatcggtatgggcgtctgatgtcgct
tatgcagaaaccggtattcagctttctttcgatggtagttggggacaagggaagctttct
gttccactgattggtcagttcaacgcatcaaatgtactggttgctttctcgactctgctt
tcattgggcatcgataaacaaatcttggtcgacactgcatctcaacttcaacctgtgatt
ggccgtatggagcttttccaaactccgaacaaagcaaaagtggttgtcgattacgctcat
acgcccgatgcgctagaaaaagcattggcagcattgcgtgtgcattgctctgggcaactg
tgggcaatcttcggctgtggtggtgatcgtgacaccggtaagcgcccaatgatggcggta
acggcagagcagttcgccgacaaaattattatttcagatgacaaccctcgcagcgaagat
cctgctttgattgttaaagacatgctagctggcttaagcgaaccagaatctgcattcgtc
gagcacgatcgctatcaagcggttaagtttgccctagaacaggcaggcagtaatgacatt
attcttttggctggtaaaggccatgaggattaccaagtattgaaagacgaaacgatccat
tactcagatcgagagtccgcgctacaacttttaggtatttcataa

DBGET integrated database retrieval system