KEGG   Vibrio splendidus: VS_0513Help
Entry
VS_0513           CDS       T00812                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vsp  Vibrio splendidus
Brite
Enzymes [BR:vsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VS_0513
Secretion system [BR:vsp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VS_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:531761..532540
Genome map
AA seq 259 aa AA seqDB search
MSVLRRLPLLALPLMITACNASEAKVETTSTAVEAAPAQAIDTAALTKRFEKIGIKVDKI
VPSDIDGLLEVQTNSGIIFSSPEGDHFLAGTLYSLDENGKFSDVLAERQAPLNAEKVAAM
SDTVIEYKADNEKYVVTVFTDITCGYCVRLHSQMQGYNDLGITVRYMAYPRQGATGQVAD
QMAAIWASDDPKTAMHDAKVNRQMPASGKDLAEQKQIIAKQYQLGRELGINGTPAIVLAS
GELVSGYLPPAQLIQRLEQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccgtcttcctctactagcgcttcctctcatgattactgcatgtaat
gcatcagaagcgaaagtagaaacaacatcaacagccgtagaagctgctccagctcaagct
attgatacagctgcgttaactaagcgttttgaaaaaatcggtattaaggtcgataagatt
gttccttcggatatcgatggtcttttagaagttcaaaccaacagcggtattatcttttct
tctccagagggcgatcactttctagccggtacactttactctttggatgaaaacggtaag
ttcagtgatgttttggctgagcgtcaagctccactgaatgctgagaaagttgcagcgatg
tcggatacggttatcgaatataaagcagataacgaaaagtacgttgtgacggtatttact
gacattacgtgtggctactgtgttcgtctgcacagccaaatgcaaggctacaacgatctg
ggtatcaccgttcgttacatggcttacccacgccaaggtgcgacaggacaagttgccgat
caaatggcggcaatctgggcgtctgacgatccaaaaacagctatgcatgatgctaaagtc
aatcgtcaaatgccagcgtctggtaaagacctagcagagcaaaagcagatcattgctaaa
caataccaactcggtcgtgagcttggcatcaatggcactccggctatcgtgctagcaagt
ggtgagttggtgagtggttacttacctccggcgcaacttattcagcgtttagagcagtaa

DBGET integrated database retrieval system