KEGG   Vibrio splendidus: VS_0546Help
Entry
VS_0546           CDS       T00812                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vsp  Vibrio splendidus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vsp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:vsp00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:568437..569414
Genome map
AA seq 325 aa AA seqDB search
MGPLWVDVAGYELTAEDREILDHPTVGGLILFARNYHDSKQLSALNKEIRKVAKRPILIG
VDQEGGRVQRFRDGFSIIPAAQEFATKNDGEQLAEQAGWLMAAELIAHDIDLSFAPVLDK
GHDCKAIGSRAFGEDIDTIVRHSSAFIKGMKSVGMATTGKHFPGHGGVIADSHLETPYDP
RDDIFETDMAIFKAQIEAGILDAMMPAHVVFSHYDDQPASGSQYWLQKVLKQQLGFKGLV
FSDDLTMEGAAIMGGPADRAKAALSAGCDMVLMCNKRDAQIEALDHLAIQEVPLANSLLK
KHSFDLSTLHSDSRWKEASEQIKRM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgttgtgggtagatgtcgcgggctacgaactgacagctgaagacagagaaatt
ttagatcacccaaccgttggtggtctcatcttattcgctcgaaactaccacgatagcaaa
cagctttcggcgttaaataaagagatccgcaaggtagcgaaacgtcctattttgattggc
gttgaccaagaaggtggccgagttcagcgctttcgtgatggcttttcaattatccctgca
gctcaagaatttgcgactaagaacgatggtgagcagttagcagaacaagccggctggttg
atggcggcggaattgattgcccatgatatcgatctgagctttgcgccggtattagacaaa
ggccacgactgtaaagcgattggtagccgagcgtttggtgaagatattgataccattgtt
cgtcacagcagcgcttttattaaaggcatgaaatcggttggaatggcgacaacagggaag
cacttcccaggacacggcggtgtaattgctgattcgcacttagaaacgccttacgatcct
agagatgatatctttgaaacagacatggccattttcaaggcgcaaattgaagccggaata
ttggatgccatgatgcctgcacacgttgttttctctcactatgatgatcagccagcgagt
ggctcacagtattggttgcagaaagtattgaagcagcagcttggattcaaaggcttagtt
ttttctgacgacttaacgatggaaggcgctgccattatgggcggaccagcagatagagcg
aaagcagccttgagtgctggctgtgacatggtgctgatgtgtaataagcgagatgcacaa
attgaggctcttgatcatttagcgattcaagaggtgcctttagccaactcattgcttaaa
aagcacagctttgatttatcgacgcttcactcggatagtcgatggaaagaggcctcagag
caaattaagcgaatgtaa

DBGET integrated database retrieval system