KEGG   Vibrio splendidus: VS_0546Help
Entry
VS_0546           CDS       T00812                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vsp  Vibrio splendidus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VS_0546
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VS_0546
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VS_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:568437..569414
Genome map
AA seq 325 aa AA seqDB search
MGPLWVDVAGYELTAEDREILDHPTVGGLILFARNYHDSKQLSALNKEIRKVAKRPILIG
VDQEGGRVQRFRDGFSIIPAAQEFATKNDGEQLAEQAGWLMAAELIAHDIDLSFAPVLDK
GHDCKAIGSRAFGEDIDTIVRHSSAFIKGMKSVGMATTGKHFPGHGGVIADSHLETPYDP
RDDIFETDMAIFKAQIEAGILDAMMPAHVVFSHYDDQPASGSQYWLQKVLKQQLGFKGLV
FSDDLTMEGAAIMGGPADRAKAALSAGCDMVLMCNKRDAQIEALDHLAIQEVPLANSLLK
KHSFDLSTLHSDSRWKEASEQIKRM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgttgtgggtagatgtcgcgggctacgaactgacagctgaagacagagaaatt
ttagatcacccaaccgttggtggtctcatcttattcgctcgaaactaccacgatagcaaa
cagctttcggcgttaaataaagagatccgcaaggtagcgaaacgtcctattttgattggc
gttgaccaagaaggtggccgagttcagcgctttcgtgatggcttttcaattatccctgca
gctcaagaatttgcgactaagaacgatggtgagcagttagcagaacaagccggctggttg
atggcggcggaattgattgcccatgatatcgatctgagctttgcgccggtattagacaaa
ggccacgactgtaaagcgattggtagccgagcgtttggtgaagatattgataccattgtt
cgtcacagcagcgcttttattaaaggcatgaaatcggttggaatggcgacaacagggaag
cacttcccaggacacggcggtgtaattgctgattcgcacttagaaacgccttacgatcct
agagatgatatctttgaaacagacatggccattttcaaggcgcaaattgaagccggaata
ttggatgccatgatgcctgcacacgttgttttctctcactatgatgatcagccagcgagt
ggctcacagtattggttgcagaaagtattgaagcagcagcttggattcaaaggcttagtt
ttttctgacgacttaacgatggaaggcgctgccattatgggcggaccagcagatagagcg
aaagcagccttgagtgctggctgtgacatggtgctgatgtgtaataagcgagatgcacaa
attgaggctcttgatcatttagcgattcaagaggtgcctttagccaactcattgcttaaa
aagcacagctttgatttatcgacgcttcactcggatagtcgatggaaagaggcctcagag
caaattaagcgaatgtaa

DBGET integrated database retrieval system