KEGG   Vibrio splendidus: VS_0676Help
Entry
VS_0676           CDS       T00812                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vsp  Vibrio splendidus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VS_0676
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VS_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:709496..711721
Genome map
AA seq 741 aa AA seqDB search
MTTTTTNTSTEAANTLKPVSLIPEQLMNVLKFLADKGSIRQLDYQFARFIAQQATSHSQE
IGFLAGVVSHELGKGHICTQLIQQHKAGPEQTTDLAQLLGLYGETALQLNQKLLGIDWVT
VLQSSNLVGTTNDCVKPLMFDGQRVYLQRYWNYEVVLAETLNRLSKPVEFNIEQKKALTE
TLNQLFARSYHFLFNALTKAEANQQTSQVLRQQLVCDHLDIVDEQALDWGSIDQAIVQAK
QVTDLDVLDSLVPLSVCLNWQKVAAAVALSRRFAVISGGPGTGKTTTVTKLLSAMVEQSL
SQGKIPTIKLVAPTGKAAARLTESIGKAIEQLPLAPEVKANIPTESSTLHRLLGAIPNRA
EFRHNRRNPLHLDILVVDEASMVDLSMMYKLVDALPEHARLILLGDKDQLASVEAGAVLG
DICSFNSTGYSTAQGNLIAEMTGFDAIAKPRQVKTGSANPPAIADSLCMLQKSYRFDARS
GIGQLAKAINNGSANQVDQVFAKGFADIENHPLSSDSYNLMLRTLVNEYGAYLNRMNVPL
EELETQEARAKSVLDLFSQCRLLCSIREGDFGVKGLNHRIERALAARRLVNPNNDELWYH
GRPVMVTRNDHGLGLYNGDIGICMLEADVSSSSSIDDNSAPRLKVYFELPDGSVKAVLPS
RVPDHETAYAMTIHKSQGSEFDLTLMILPPDFSPILTRELIYTGITRAKKRLIMFSDTNV
LKRGIKVKTERVSGLGSRLTN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacgaccactaataccagtacagaagctgcgaacacgctaaagccagtttca
cttatccctgagcagctcatgaatgtattaaagttcctagcggacaaaggttcaattcgt
cagttggattatcaatttgcccgttttattgctcagcaagcgacgagtcattctcaagag
atcgggtttctagctggcgttgtaagccatgaattaggcaaggggcatatttgtactcag
cttatacagcagcataaggcaggccctgaacaaacgacagatctagcccagttgcttggt
ttgtacggtgaaacggcactgcaattgaaccaaaaactgttgggtattgattgggtgact
gttctgcaatcatctaacctagttggaacaactaatgactgcgttaagccgctgatgttt
gatgggcagcgtgtctacttacagcgttattggaactacgaagttgtgttggctgaaact
ctaaaccgtttaagtaagccagtagagttcaatattgagcagaaaaaagcactgactgag
acgctcaatcagctttttgcacgcagttatcacttcctgtttaatgccttaaccaaggct
gaagcaaaccaacaaacctctcaggtattacgtcagcagttagtgtgtgaccatctagat
atcgtcgatgaacaggctttggattggggttctatcgatcaagcgattgttcaagccaaa
caagtgaccgatttagatgtgctggatagtctagtgccgttatctgtctgtttgaactgg
caaaaagtagcggcagcggtggcgttaagtcgtcgcttcgcggtgatttctggtgggccg
ggtaccggtaaaacgaccacggtaactaagttgctgtcggcgatggtcgagcaatcactc
agccaaggtaaaataccgacgatcaagctggtggctccgacaggtaaagcggcggcgcgt
ttaactgagtcgattggtaaagcgattgaacaattacctctggcgcctgaagtaaaggcc
aacataccgacggaatcgagcactttgcaccgattacttggtgcgatccccaatcgagcg
gagtttagacacaaccgacgtaatccacttcaccttgatatcttggtggtggatgaagca
tcgatggtcgacttatccatgatgtataagctggtggatgcactccctgaacacgcaagg
ttgattctgcttggtgataaagaccagctcgcttcagtagaagcaggtgccgtgttgggt
gatatctgctcgtttaattcaacaggctacagcacagcgcaaggtaacttgattgcggaa
atgacaggctttgatgcgatagctaaacccagacaggtcaaaacaggatcggctaaccct
cctgcgattgccgatagtttgtgtatgctgcagaagagttaccgttttgatgcacgttca
ggtatcggacagttggcaaaggcgatcaataacggctctgctaatcaggtcgatcaagtg
tttgcgaaagggtttgcggatattgagaatcatcccttgtcgagtgacagctataacttg
atgctacgtactttagttaatgaatatggtgcgtatctgaaccgaatgaatgtgccattg
gaagagctagaaactcaagaagcgagagcgaaatcggttctcgatttgttcagccagtgt
cggttgctgtgttccattcgcgaaggtgactttggtgttaaaggcctcaaccacagaatc
gaaagggcacttgccgcaagacgcttggtgaatccgaacaacgatgaattgtggtatcac
gggcgaccagtaatggtaacgcgcaatgatcatggcttaggtttatacaatggtgatatt
ggtatctgtatgcttgaggctgatgtaagtagctcttcttcaattgatgataactcagcc
cctcgattaaaggtgtactttgaattgcccgatggcagtgtgaaagccgtgcttccaagc
agagtccccgatcatgagaccgcttatgcgatgacgatacacaaatctcaaggcagtgag
tttgatctgaccttaatgatcttaccgccagacttcagccctattttaacgcgagagctt
atctataccggtattacacgtgctaagaaacgactgattatgttcagcgacacaaatgtg
ttgaagcgtgggattaaggtgaaaacagagcgagtgagtggtttaggaagtcgattaact
aactga

DBGET integrated database retrieval system