KEGG   Vibrio splendidus: VS_0676Help
Entry
VS_0676           CDS       T00812                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vsp  Vibrio splendidus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vsp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:709496..711721
Genome map
AA seq 741 aa AA seqDB search
MTTTTTNTSTEAANTLKPVSLIPEQLMNVLKFLADKGSIRQLDYQFARFIAQQATSHSQE
IGFLAGVVSHELGKGHICTQLIQQHKAGPEQTTDLAQLLGLYGETALQLNQKLLGIDWVT
VLQSSNLVGTTNDCVKPLMFDGQRVYLQRYWNYEVVLAETLNRLSKPVEFNIEQKKALTE
TLNQLFARSYHFLFNALTKAEANQQTSQVLRQQLVCDHLDIVDEQALDWGSIDQAIVQAK
QVTDLDVLDSLVPLSVCLNWQKVAAAVALSRRFAVISGGPGTGKTTTVTKLLSAMVEQSL
SQGKIPTIKLVAPTGKAAARLTESIGKAIEQLPLAPEVKANIPTESSTLHRLLGAIPNRA
EFRHNRRNPLHLDILVVDEASMVDLSMMYKLVDALPEHARLILLGDKDQLASVEAGAVLG
DICSFNSTGYSTAQGNLIAEMTGFDAIAKPRQVKTGSANPPAIADSLCMLQKSYRFDARS
GIGQLAKAINNGSANQVDQVFAKGFADIENHPLSSDSYNLMLRTLVNEYGAYLNRMNVPL
EELETQEARAKSVLDLFSQCRLLCSIREGDFGVKGLNHRIERALAARRLVNPNNDELWYH
GRPVMVTRNDHGLGLYNGDIGICMLEADVSSSSSIDDNSAPRLKVYFELPDGSVKAVLPS
RVPDHETAYAMTIHKSQGSEFDLTLMILPPDFSPILTRELIYTGITRAKKRLIMFSDTNV
LKRGIKVKTERVSGLGSRLTN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacgaccactaataccagtacagaagctgcgaacacgctaaagccagtttca
cttatccctgagcagctcatgaatgtattaaagttcctagcggacaaaggttcaattcgt
cagttggattatcaatttgcccgttttattgctcagcaagcgacgagtcattctcaagag
atcgggtttctagctggcgttgtaagccatgaattaggcaaggggcatatttgtactcag
cttatacagcagcataaggcaggccctgaacaaacgacagatctagcccagttgcttggt
ttgtacggtgaaacggcactgcaattgaaccaaaaactgttgggtattgattgggtgact
gttctgcaatcatctaacctagttggaacaactaatgactgcgttaagccgctgatgttt
gatgggcagcgtgtctacttacagcgttattggaactacgaagttgtgttggctgaaact
ctaaaccgtttaagtaagccagtagagttcaatattgagcagaaaaaagcactgactgag
acgctcaatcagctttttgcacgcagttatcacttcctgtttaatgccttaaccaaggct
gaagcaaaccaacaaacctctcaggtattacgtcagcagttagtgtgtgaccatctagat
atcgtcgatgaacaggctttggattggggttctatcgatcaagcgattgttcaagccaaa
caagtgaccgatttagatgtgctggatagtctagtgccgttatctgtctgtttgaactgg
caaaaagtagcggcagcggtggcgttaagtcgtcgcttcgcggtgatttctggtgggccg
ggtaccggtaaaacgaccacggtaactaagttgctgtcggcgatggtcgagcaatcactc
agccaaggtaaaataccgacgatcaagctggtggctccgacaggtaaagcggcggcgcgt
ttaactgagtcgattggtaaagcgattgaacaattacctctggcgcctgaagtaaaggcc
aacataccgacggaatcgagcactttgcaccgattacttggtgcgatccccaatcgagcg
gagtttagacacaaccgacgtaatccacttcaccttgatatcttggtggtggatgaagca
tcgatggtcgacttatccatgatgtataagctggtggatgcactccctgaacacgcaagg
ttgattctgcttggtgataaagaccagctcgcttcagtagaagcaggtgccgtgttgggt
gatatctgctcgtttaattcaacaggctacagcacagcgcaaggtaacttgattgcggaa
atgacaggctttgatgcgatagctaaacccagacaggtcaaaacaggatcggctaaccct
cctgcgattgccgatagtttgtgtatgctgcagaagagttaccgttttgatgcacgttca
ggtatcggacagttggcaaaggcgatcaataacggctctgctaatcaggtcgatcaagtg
tttgcgaaagggtttgcggatattgagaatcatcccttgtcgagtgacagctataacttg
atgctacgtactttagttaatgaatatggtgcgtatctgaaccgaatgaatgtgccattg
gaagagctagaaactcaagaagcgagagcgaaatcggttctcgatttgttcagccagtgt
cggttgctgtgttccattcgcgaaggtgactttggtgttaaaggcctcaaccacagaatc
gaaagggcacttgccgcaagacgcttggtgaatccgaacaacgatgaattgtggtatcac
gggcgaccagtaatggtaacgcgcaatgatcatggcttaggtttatacaatggtgatatt
ggtatctgtatgcttgaggctgatgtaagtagctcttcttcaattgatgataactcagcc
cctcgattaaaggtgtactttgaattgcccgatggcagtgtgaaagccgtgcttccaagc
agagtccccgatcatgagaccgcttatgcgatgacgatacacaaatctcaaggcagtgag
tttgatctgaccttaatgatcttaccgccagacttcagccctattttaacgcgagagctt
atctataccggtattacacgtgctaagaaacgactgattatgttcagcgacacaaatgtg
ttgaagcgtgggattaaggtgaaaacagagcgagtgagtggtttaggaagtcgattaact
aactga

DBGET integrated database retrieval system