KEGG   Vibrio tasmaniensis: VS_0865Help
Entry
VS_0865           CDS       T00812                                 

Definition
(GenBank) Fatty acid oxidation complex alpha subunit
  KO
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vsp  Vibrio tasmaniensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_0865
   01212 Fatty acid metabolism
    VS_0865
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VS_0865
   00650 Butanoate metabolism
    VS_0865
  Lipid metabolism
   00071 Fatty acid degradation
    VS_0865
   01040 Biosynthesis of unsaturated fatty acids
    VS_0865
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VS_0865
   00310 Lysine degradation
    VS_0865
   00380 Tryptophan metabolism
    VS_0865
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VS_0865
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VS_0865
   00281 Geraniol degradation
    VS_0865
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VS_0865
   00930 Caprolactam degradation
    VS_0865
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VS_0865
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VS_0865
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VS_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:885809..888055
Genome map
AA seq 748 aa AA seqDB search
MSMTLDVKKEKKAVKKTDSKPVTVSKSDKTVSNDEAVKPATAFSLTIDDQDIAWLAIDVP
NEKMNTLQAAFAEEMKAIFEQLKEKQSRVKGLIVHSLKPDNFIAGADVRMLDACKTADEA
QSLARQGQEMFQALSDLPYPVVAAIHGPCLGGGLELALSCDYRVCTDSDKTRLGLPEVQL
GLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAKSLGVVDACVPETILLEVAKSFVE
KNSGGKKGKRLASKSQASAKEKLISRTGLGRKVIFEQASKKTNQKTRGNYPAADAILDVI
RYGLENGFDKGLQYEAKRFSELVMTAESKALRSIFFATTEMKKEHGADAEPKAVKRVGVL
GGGLMGAGISHVSVAKAKVPVRIKDVSNEGVLNALNYNYKLFDKQRKRRILSRAGLESKM
LQLSGGIDFTSFNHTDVVIEAVFEDLDLKQSMVADIEANAKPSTIFATNTSSLPIHKIAE
KAQRPENVVGLHYFSPAEKMPLVEVIPHETTSEETISTVVALAKKQGKTPIVVKDTAGFY
VNRILAPYMNEAAHLLLANEPIEKLDSTLLDFGFPVGPITLLDEVGVDIGAKIIPILVNE
LGERFQGPDVFDILLNDNRKGRKSGKGFYTYKGKKKEVDKSVYKLLKLQPEPKLSDNDIT
MRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPFRYMDQIGIKSLVEMMN
DFAKKYGDRFAPCDGLLTRAGLDESFYK
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgactcttgatgtgaaaaaagaaaagaaagcagtcaaaaaaacggattcaaag
ccagtgactgtatctaaaagtgataagacggtttcaaacgatgaagccgtaaaaccggcg
accgcgttttctttaactatcgatgaccaagatattgcatggcttgcgatcgatgtacca
aacgaaaaaatgaacacgctacaagcggcgtttgccgaagaaatgaaagcaatcttcgag
cagttgaaggaaaagcaaagccgagttaaaggcttaatcgttcattcattgaagccagat
aattttattgctggcgctgatgttcgaatgcttgatgcctgcaaaacggctgatgaagca
caatctctcgctcgtcaggggcaagagatgttccaagcgctttctgatttgccttatcct
gttgtcgcagcgattcacggtccatgtttaggtggtggcttagagctagcactatcgtgt
gattaccgtgtatgtacagactcagacaagactcgccttggcttgccagaagtccaactt
ggtctgttacccggatctggtggtacgcaacgtcttcctcgtcttatcggtttactgcct
tctcttgaccttattcttacgggtaagcaactgcgcgctaaaaaagcgaaatcgctaggt
gtcgtggatgcttgtgtgccagaaactatcttgctggaagttgctaagagctttgttgaa
aagaactcaggcgggaaaaaaggtaagcgcttggcgtctaaaagccaagcttcggccaaa
gaaaaactaatttcacgtacgggtcttggtcgcaaggttatttttgaacaggcttcaaag
aagaccaatcagaaaacacgcggtaattacccagccgctgatgcgattcttgatgtgatt
cgttatggcttagagaacggctttgataaaggtcttcagtacgaagcgaagcgtttctct
gaattggtgatgaccgcagaatccaaagcccttcgttcgattttctttgcaacgactgaa
atgaaaaaagaacacggcgcagacgcagaaccgaaagcggttaagcgtgttggtgtgcta
ggtggcggtctaatgggcgctggtatcagccacgtcagtgttgctaaagcgaaagtcccg
gttcgtattaaagatgtgtctaatgaaggtgtgctcaatgcgcttaactacaactacaag
ttgttcgataagcagcgtaaacgtcgtatcctgagccgagctggccttgaaagtaagatg
cttcagctttctggtggtatcgactttacaagctttaaccatactgatgtggtgattgaa
gcggtatttgaagatcttgaccttaagcagtcgatggttgcggacattgaagccaatgcc
aagcctagtactatcttcgcgaccaacacttcttcattgccaattcataagattgcagag
aaggcgcaacgaccagaaaacgtggtcggtcttcactacttcagcccagcagaaaaaatg
ccgctagtagaagtcatccctcatgaaacaacgtcagaagagactatttcgacggttgtt
gcattagcgaagaagcaaggtaaaaccccgattgttgttaaagatacggctggcttctac
gtgaaccgtattcttgctccatacatgaatgaagctgcgcatctgttattggcaaatgag
ccgattgaaaagctcgacagcacgttgctggactttggtttcccggttggcccaattact
ttgttagacgaagtcggtgttgatatcggtgcgaagatcatcccgattctagttaatgaa
ttaggcgaacgtttccaaggccctgatgtgttcgacattcttttgaatgacaaccgtaaa
ggccgtaagagtggcaaaggtttctacacttacaaaggtaagaagaaggaagtcgataag
tcagtttacaaactgcttaagctgcaacctgaacctaagctaagcgataacgacatcaca
atgcgttgtgtgttaccgatgctcaacgaagcggttcgttgtttggatgatggcattatc
cgtagccctagagatggcgatattggtgctattttcggtatcggcttcccgccattccta
ggtggtccgttccgttatatggatcaaatcggtattaagtcactggtagagatgatgaac
gacttcgctaagaagtacggtgatcgttttgcgccatgtgatggcctactgacacgtgct
ggattggatgagtctttttataagtaa

DBGET integrated database retrieval system