KEGG   Vibrio tasmaniensis: VS_0918Help
Entry
VS_0918           CDS       T00812                                 

Definition
(GenBank) Recombination protein recR
  KO
K06187  
recombination protein RecR
Organism
vsp  Vibrio tasmaniensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VS_0918
DNA repair and recombination proteins [BR:vsp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     VS_0918
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VS_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:944352..944951
Genome map
AA seq 199 aa AA seqDB search
MRTSHMLEHLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMTEIGHCNEC
RTFTEEETCHICTNPKRQDNGQICVVESPADIAAIEATGQYSGRYFVLMGHLSPLDGIGP
SDIGLDVLDYRLRRGDITEVILATNPTVEGEATAHYIAELCNAHEVNASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagtcatatgctggagcatttgatggaggccttacgttgtctacctggggtt
ggccccaagtcggcgcagcgtatggcctttcatttgttacagcgcgatagaaaaggcggc
ctgcagttggctgaagctcttagccaagcaatgacagaaattggtcattgtaatgagtgc
cgtacttttaccgaagaagagacctgccacatttgtaccaatcctaaacgtcaggataac
ggtcaaatttgtgtagtagagagccctgcagacattgcagccattgaagcaacgggtcaa
tattccggtcgttactttgtgcttatgggacatctttcaccacttgatggtattggtcca
agtgacatcggtctcgatgtcttggattaccgcttacgtcgtggtgatatcactgaagtt
attttagcgactaacccgacagtagaaggggaggcgacagcacattacattgctgagcta
tgtaatgcccatgaagtgaacgctagccgtatcgcccatggtgttcctgttggtggtgag
ctcgagctggtggatggcaccacgctttcacactcgttactcggtcgtcataaaatctaa

DBGET integrated database retrieval system