KEGG   Vibrio splendidus: VS_0958Help
Entry
VS_0958           CDS       T00812                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vsp  Vibrio splendidus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VS_0958
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VS_0958
   00620 Pyruvate metabolism
    VS_0958
   00650 Butanoate metabolism
    VS_0958
  Lipid metabolism
   00071 Fatty acid degradation
    VS_0958
  Amino acid metabolism
   00350 Tyrosine metabolism
    VS_0958
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VS_0958
   00626 Naphthalene degradation
    VS_0958
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VS_0958
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VS_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:987660..990368
Genome map
AA seq 902 aa AA seqDB search
MPVTNLAELDALVARVKAAQEEFATFSQEKVDAIFRAASLAANHARIPLAQQAVAESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILDEDESLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDGIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASILMSKTF
DNGVVCASEQAAIVVSEVYDEVKERFASHKAHVLSKADADKVRKVLLIDGNLNAKIVGQP
APAIAEMAGVKVPADTKVLVGEGLGKVSYDDEFAHEKLSPTLGLFRADDFEDAVAQAVTM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKMKTARILINIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIAMSDLEGKKR
AFLVTDRFLFNNGYADDVVQILKSQGIEVQVFFDVEADPTLSVVEKGAEAMKSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYEITPNMAVVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYKNGSADPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKIGAEFHLPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLTWLEELKVDLDIPLSIQAAGVNESDFIAKLDELAVEAFDDQC
TGANPRYPLITELKEVLTTSYFGKAYVEGETFEGTTVILKKADQKPAEEKAAPKAKKEKA
NA
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaacttagcggaacttgatgctctagtagcacgcgttaaagcagcacaa
gaagagtttgcaacattctctcaagagaaagtagacgcaatcttccgcgcagcttctctt
gctgctaaccacgctcgtatcccacttgcacaacaagcagttgctgaatctggaatgggt
attgttgaagataaggttatcaaaaaccactttgcatctgaatttatctacaacaaatac
aaagacgaaaaaacatgtggcattcttgatgaagatgaaagcctaggcacaatgactatc
gctgagcctgtaggtatcatctgtggtatcgttccaacaacgaacccaacttctacagca
atcttcaaatctctaatctctcttaaaacacgtaacggcatcatcttctcgccacaccca
cgtgcaaagaactcaactaatgacgcagcgaagcttgttctagacgcagctgtagcagcg
ggtgcaccaaaagacatcatcggttggatcgaccaaccatctgtagagctttctaacgcg
ctgatgaagcacgacggtatcgctcttatccttgctactggtggtccaggcatggttaaa
gcagcatactcttctggtaagcctgctatcggtgttggtgctggtaacgttcctgtagtt
atcgatgaaacagctgacatcaaacgtgcagtagcatctatccttatgtctaaaacattc
gataacggtgttgtatgtgcttctgagcaagctgcaatcgtagttagcgaagtatatgac
gaagttaaagagcgttttgcttctcacaaagctcacgttttatctaaagctgacgcagat
aaagtacgtaaagttcttcttatcgacggcaacctaaacgctaaaatcgtaggtcaacct
gctccagcaatcgctgaaatggcgggtgttaaagttcctgctgatacaaaagtacttgta
ggtgaaggccttggtaaagtttcttacgatgacgaatttgctcacgagaaactgtctcca
actctaggtctattccgcgcagacgatttcgaagacgctgttgctcaagcagtaactatg
gttgaaatcggtggtatcggtcacacatctggtctttacactaaccaagacgtaaacgca
gatcgcatccgttacttcggtgacaagatgaagacggctcgtatcctaatcaacatcccg
actactcacggtggtatcggtgacctgtacaactttaacgttgcaccttctctaactctt
ggttgtggttcatggggtggtaactctatctctgagaacgtaggtcctaagcaccttatc
aacaagaaaactgtagcgaagcgagctgaaaatatgttgtggcacaaactacctaagtct
atctacttccgtcgtggcagccttccaatcgcaatgagcgacctagaaggtaagaaacgc
gcattcctagtaactgaccgtttcttgttcaacaacggttacgcagatgacgtagtacaa
atcctgaaatctcaaggtattgaagttcaagtattcttcgatgtagaagcggatccaaca
ttgtctgttgttgagaaaggcgctgaagcaatgaagagcttccaacctgacgtaatcctt
gctctaggtggcggttctccaatggatgctgctaagatcatgtgggttatgtacgagcac
ccagaaactcacttcgaagaactagcaatgcgctttatggatatccgtaaacgtatctac
aagttccctaaaatgggtaaaaaagctgagctagtatgtatcactactacttcaggtacg
ggttcagaagttacgccattcgcggttgttactgacgacaaaacaggtgctaagtaccca
ctagcagattacgaaatcacgccaaacatggctgttgttgatgctaacctagtaatgaac
atgcctaagtctctaacagcgttcggtggttacgatgcagtaactcacgctcttgaagct
tacgtatcagttcttgcgaacgaatactcagatggtcaagctctacaagctcttaagatg
cttaaagaatacctaccatcaagctacaaaaacggttcagcagacccaatcgctcgtgag
aaagtacacaacgctgcaacgattgctggtattgcctttgcgaacgcattcctaggtgta
tgtcactcaatggctcacaaaattggtgctgagttccacctaccacacggtcttgcaaac
gcactacttatctcaaacgttgtacgttacaacgcgaacgataacccaactaagcagact
gcattctctcagtacgaccgcccacaagcacgtcgtcgttatgctgaagttgctgaccac
ctaggcctaagccaagctggtgaccgtactgcgcagaagattgaacgtctactgacttgg
ttagaagagcttaaagttgacctagacatcccactgtctatccaggctgcgggtgttaac
gagtctgacttcatcgctaaactagacgagctagctgttgaagcgttcgatgaccagtgt
acaggtgctaacccacgttaccctctaatcactgagcttaaagaagttctaacaacgtct
tacttcggtaaagcatacgttgaaggtgaaacttttgaaggtacgactgtaattttgaag
aaagctgaccaaaagccagctgaagaaaaagcagcaccaaaagctaaaaaagaaaaagct
aacgcataa

DBGET integrated database retrieval system