KEGG   Vibrio tasmaniensis: VS_1107Help
Entry
VS_1107           CDS       T00812                                 

Definition
(GenBank) Holliday junction DNA helicase ruvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vsp  Vibrio tasmaniensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VS_1107
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     VS_1107
DNA repair and recombination proteins [BR:vsp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     VS_1107
    RecFOR pathway proteins
     VS_1107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1171704..1172315
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGTLIEKQPPELLIEVSGVGYEVQMPMSCFYELPNVGEEAIIYTHFVVREDAQLL
YGFNTVKERALFREVIKANGVGPKLGLGILSGMTASQFVQSVEREDISTLVKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPATDAAPMDSMPTVHDAEEEAVSALLALGYKPTQASKV
VSQVAKDGMTSEQLIREALKSMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgtctccgcggtacattaatagaaaaacagccaccagagttattgattgaa
gtcagtggtgttggttatgaagttcaaatgccaatgagctgtttttatgagttaccaaac
gtaggcgaagaggcaattatctacactcattttgtggtacgtgaagatgctcagctactt
tatggttttaacacggttaaagagcgtgccttgttccgtgaagtgattaaagctaatggt
gtcggccctaaacttggtcttgggattctttcaggcatgaccgctagccaattcgttcag
agcgttgaacgagaagatatctctacgctggttaaactgccgggtgttggtaagaaaacg
gcagaacgccttgttgttgaaatgaaagaccgcctgaaagggtggggcgcaggtgatctg
tttacacctgcaacagatgcagcgccaatggactctatgccaacggtgcacgacgcggaa
gaagaagcggtaagtgcgctacttgcattaggctacaagccgactcaagcttctaaggtg
gtttctcaagtagctaaagatggcatgaccagcgaacagttgattcgcgaagctctgaaa
tcgatggtttaa

DBGET integrated database retrieval system