KEGG   Vibrio splendidus: VS_1107Help
Entry
VS_1107           CDS       T00812                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vsp  Vibrio splendidus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vsp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1171704..1172315
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGTLIEKQPPELLIEVSGVGYEVQMPMSCFYELPNVGEEAIIYTHFVVREDAQLL
YGFNTVKERALFREVIKANGVGPKLGLGILSGMTASQFVQSVEREDISTLVKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPATDAAPMDSMPTVHDAEEEAVSALLALGYKPTQASKV
VSQVAKDGMTSEQLIREALKSMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgtctccgcggtacattaatagaaaaacagccaccagagttattgattgaa
gtcagtggtgttggttatgaagttcaaatgccaatgagctgtttttatgagttaccaaac
gtaggcgaagaggcaattatctacactcattttgtggtacgtgaagatgctcagctactt
tatggttttaacacggttaaagagcgtgccttgttccgtgaagtgattaaagctaatggt
gtcggccctaaacttggtcttgggattctttcaggcatgaccgctagccaattcgttcag
agcgttgaacgagaagatatctctacgctggttaaactgccgggtgttggtaagaaaacg
gcagaacgccttgttgttgaaatgaaagaccgcctgaaagggtggggcgcaggtgatctg
tttacacctgcaacagatgcagcgccaatggactctatgccaacggtgcacgacgcggaa
gaagaagcggtaagtgcgctacttgcattaggctacaagccgactcaagcttctaaggtg
gtttctcaagtagctaaagatggcatgaccagcgaacagttgattcgcgaagctctgaaa
tcgatggtttaa

DBGET integrated database retrieval system