KEGG   Vibrio splendidus: VS_1239Help
Entry
VS_1239           CDS       T00812                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vsp  Vibrio splendidus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vsp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1316200..1317126
Genome map
AA seq 308 aa AA seqDB search
MNDLFTKPDYSLYSNAMTFMRRPLVQNPIDNDADVVVLGAPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNVFEHTSVIDAGDLVFDCGDAEDLTQRLEAAADAILNSGKTLL
GLGGDHFITLPLLRAYGKKYGEMALIHFDAHTDTYSQGSRYDHGTMFYHAPNEGLISPEH
SVQIGIRTEYKQEGHGFNVINAMQANDMSVDEIIAQVKGIVGDKPVYVTFDIDCLDPAFA
PGTGTPVCGGLNSDKVLKIIRGLQGINMVGMDVVEVSPAYDQSEITALAGATIALELLYV
WTANRLTK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctatttaccaaaccagattactcgctgtactccaacgcgatgacgtttatg
cgtcgcccattggtgcagaacccaattgataacgatgctgatgtggttgtgttgggcgcg
ccgttagatatggcgacgtcgggtcgtccgggtgctcgtatgggacctgatgcgattcgt
cgtgcgtctgtaaacttggcgtgggaaggcaaaaaatttccttgggacttcaatgtattt
gaacacacctcggtgattgatgctggcgatcttgtgtttgattgcggtgatgcagaagac
ttaactcagcgtctagaagcagccgctgatgcgattctaaacagcggtaaaacactgtta
gggttaggtggcgatcacttcattacattgcctttgctaagagcatacggcaagaagtac
ggtgaaatggctctgattcattttgacgcgcacactgatacttacagtcagggtagtcgt
tacgatcacggtactatgttctaccatgcgccaaatgaagggttaatctcgcctgagcat
tctgtgcaaataggtattcgtacagagtataagcaggaaggtcacggctttaatgttatt
aatgcgatgcaagcgaatgacatgagcgtggatgagatcattgctcaagtaaaaggtatt
gttggcgacaaacctgtttatgtaacgtttgatattgactgtctagaccctgcgtttgca
ccgggtacgggcacaccagtgtgtggtggtttgaattcagataaagtgctcaaaataatc
cgtggcttacaaggtatcaacatggttggtatggatgtggtagaagtgtctccagcctat
gaccaaagcgaaattaccgctctagctggtgcaactatcgcacttgagctgctttacgtt
tggacggcaaatcgcttaacaaaataa

DBGET integrated database retrieval system