KEGG   Vibrio splendidus: VS_1748Help
Entry
VS_1748           CDS       T00812                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vsp  Vibrio splendidus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VS_1748
Enzymes [BR:vsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VS_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1870918..1871430
Genome map
AA seq 170 aa AA seqDB search
MANVYVSIGSNINREHHVTESLKALNDRFAPLHISNFYDCEPVGFEGDNFLNLVVGFECN
LPVAELIQVLHQIEAENDRKRQTKAYASRTMDIDILLYGNQVGIIDGVELPRGEITEYAF
VLRPLVDIAAQERHPTLDISFQQLWESFDQLSQKTEPIPFDISFTQPFHD
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgtctacgtcagcatcggaagcaacattaaccgcgaacaccacgtcacagaa
tctctcaaagcattgaatgaccgctttgcaccactgcacatctctaatttttacgattgc
gagcctgtcggtttcgaaggggataacttcttaaaccttgtcgttggattcgaatgtaac
cttcctgtcgccgaactgattcaggttctacatcaaatcgaagcagagaatgatcgcaag
cgtcagaccaaagcctatgcttcacgcacgatggatatcgacatccttctttatggtaat
caagtcggcattattgatggcgtagagctgcctagaggcgaaatcaccgagtacgcattt
gtactcagaccgttagtcgatattgccgcgcaagaacgccaccccactctagacatctca
tttcagcagctctgggaaagcttcgatcaattgagccaaaaaaccgaacccatccctttc
gatatcagtttcactcagcctttccatgactga

DBGET integrated database retrieval system