KEGG   Vibrio splendidus: VS_1750Help
Entry
VS_1750           CDS       T00812                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vsp  Vibrio splendidus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vsp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1871946..1872584
Genome map
AA seq 212 aa AA seqDB search
MLNTEAEKVREALLARGLETPMTPSEMNPNQKYNRIKGLLTEVVSTLGLDLNDDSLAETP
HRIAKMYVHEIFSGLDYDNFPKISVIENKMSVDEMVKVSDIDLTSTCEHHFITIDGLAEV
AYIPENKILGLSKINRIVRFFAQRPQVQERLTQQILVAIQTLVETENVAVTIKASHYCVK
SRGVMDANSETSTTALGGIFKTNPQTRAEFLR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacacagaagccgaaaaagtaagagaagctttgctcgcaagaggacttgaaact
ccaatgacaccgagcgaaatgaatcccaaccagaagtacaaccgcatcaagggactctta
acagaagttgtcagtacgcttggactggatttaaacgatgacagccttgctgaaacacct
catcgcattgcaaagatgtacgtccatgagattttttcagggcttgattacgataatttc
ccaaaaatcagtgttatagaaaataaaatgtcggttgatgaaatggttaaggtatcggat
atcgacttaacatctacgtgcgaacatcacttcattactattgatggtttagcggaagtg
gcttatatacctgaaaacaaaattcttgggctgtctaaaatcaaccgtatcgttcgattc
tttgctcagcgtcctcaggtacaagaacgccttacacaacaaatcttggttgcgatacag
actctcgttgaaacagaaaacgtggcagtgacgattaaagcgtcgcactattgcgttaaa
tccagaggcgtcatggatgcaaactctgaaacctcaacgactgcactcggtggcattttc
aaaactaaccctcaaaccagagctgagtttttacgatga

DBGET integrated database retrieval system