KEGG   Vibrio splendidus: VS_1751Help
Entry
VS_1751           CDS       T00812                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
vsp  Vibrio splendidus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VS_1751
   00670 One carbon pool by folate
    VS_1751
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VS_1751
    1.5.1.-  
     VS_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1872581..1873297
Genome map
AA seq 238 aa AA seqDB search
MSETILITGVGKRLGFALAQQLLADGYNVVGTYRNDYPQLQLLRDSGADLQQVDFYQQSS
LEGFLDYVGQEYKTLRAVIHNASDWKPESKKDPSDNASQIMHQMMTIHATVPYLFNLTLK
DQLMSGDETSDIIHISDYVAEKGSKKHIAYAASKAALNNLTLSFSAMLAPKVKVNTLSPA
MIKFNEHDDEAYKTKALKKALIPTEAGFEEIIDGIKFVLASHYMTGRTLHLDGGRHLK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacaatcctgataaccggcgtgggaaagcgactcggattcgcactggcgcag
caacttttagcggatggatacaatgtggttggcacttaccgcaacgactatcctcaattg
caactgttgcgcgacagtggagccgacttgcagcaagtagacttttatcaacaaagcagc
ctagagggctttcttgattatgttggtcaagaatataagacactcagagccgtcatacac
aacgcttcggactggaaacctgagagcaagaaagatcccagtgacaatgcatcccaaatc
atgcaccagatgatgacgattcacgctaccgtgccttatctgttcaatttaacactcaaa
gaccaactgatgtctggcgatgaaacttcagacatcatccacatcagtgattacgttgcg
gaaaaaggcagtaaaaaacacatcgcttacgcggccagtaaagctgcgctcaacaaccta
acgctgtcgttttcagcgatgctggctcccaaggtcaaagtaaataccctctctccagcc
atgattaagtttaatgaacatgacgatgaggcatacaaaaccaaagcgctgaagaaagct
ctgattcccacagaagcgggctttgaggaaataatcgatggcatcaagtttgtgttggcc
agtcactacatgacaggaagaaccttacacctagatggcggcagacatttgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system