KEGG   Vibrio tasmaniensis: VS_1751Help
Entry
VS_1751           CDS       T00812                                 

Definition
(GenBank) Oxidoreductase, short chain dehydrogenase/reductase family
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00670  One carbon pool by folate
vsp00790  Folate biosynthesis
vsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VS_1751
   00670 One carbon pool by folate
    VS_1751
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VS_1751
    1.5.1.50  dihydromonapterin reductase
     VS_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: CAV18935
UniProt: B7VPI5
Position
1:1872581..1873297
Genome map
AA seq 238 aa AA seqDB search
MSETILITGVGKRLGFALAQQLLADGYNVVGTYRNDYPQLQLLRDSGADLQQVDFYQQSS
LEGFLDYVGQEYKTLRAVIHNASDWKPESKKDPSDNASQIMHQMMTIHATVPYLFNLTLK
DQLMSGDETSDIIHISDYVAEKGSKKHIAYAASKAALNNLTLSFSAMLAPKVKVNTLSPA
MIKFNEHDDEAYKTKALKKALIPTEAGFEEIIDGIKFVLASHYMTGRTLHLDGGRHLK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacaatcctgataaccggcgtgggaaagcgactcggattcgcactggcgcag
caacttttagcggatggatacaatgtggttggcacttaccgcaacgactatcctcaattg
caactgttgcgcgacagtggagccgacttgcagcaagtagacttttatcaacaaagcagc
ctagagggctttcttgattatgttggtcaagaatataagacactcagagccgtcatacac
aacgcttcggactggaaacctgagagcaagaaagatcccagtgacaatgcatcccaaatc
atgcaccagatgatgacgattcacgctaccgtgccttatctgttcaatttaacactcaaa
gaccaactgatgtctggcgatgaaacttcagacatcatccacatcagtgattacgttgcg
gaaaaaggcagtaaaaaacacatcgcttacgcggccagtaaagctgcgctcaacaaccta
acgctgtcgttttcagcgatgctggctcccaaggtcaaagtaaataccctctctccagcc
atgattaagtttaatgaacatgacgatgaggcatacaaaaccaaagcgctgaagaaagct
ctgattcccacagaagcgggctttgaggaaataatcgatggcatcaagtttgtgttggcc
agtcactacatgacaggaagaaccttacacctagatggcggcagacatttgaagtaa

DBGET integrated database retrieval system