KEGG   Vibrio splendidus: VS_1884Help
Entry
VS_1884           CDS       T00812                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vsp  Vibrio splendidus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VS_1884
   00670 One carbon pool by folate
    VS_1884
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VS_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2028579..2029130)
Genome map
AA seq 183 aa AA seqDB search
MVWSSVRLAGSVLVHLMPGVSPMEINLKLSLMAAVAENGVIGSGLDIPWIVKGEQLLFKA
MTFNQWLLLGRKTFESMGKLPNRKYAVISRSPSTSNDPDILYFKSVEDALGYLETVTEHA
FVSGGGQIYKSLITQVDTIHISKIHKHISGDIFFPELPRDLTLVFEQRFSSNIDYTYQIW
QKG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttggtatggagttcagtgcgcttggctggctcggtgctggtgcaccttatgcccggcgtt
agccctatggagataaatttgaaattatcattgatggcagcggtagctgaaaatggagta
attggctctggcctggatataccttggattgttaagggtgagcagctgttgtttaaggca
atgacttttaatcaatggttgctacttggccgtaaaacttttgaatcaatgggaaaactg
ccaaaccgtaaatatgcggttatttctcgttctccatctacatcgaacgatcctgatatt
ttatatttcaaaagtgttgaagacgccttgggttatttagaaacagtaaccgagcatgcg
tttgtgtctggtggtggtcaaatatataagtcactcattacgcaagtggacacaattcat
atttcaaaaattcataaacatatctctggtgatattttcttccctgaactaccaagagat
ttgactctagtttttgaacagcgatttagttcaaatattgattatacgtaccaaatttgg
caaaagggctaa

DBGET integrated database retrieval system