KEGG   Vibrio splendidus: VS_1969Help
Entry
VS_1969           CDS       T00812                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vsp  Vibrio splendidus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vsp01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vsp00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2112381..2113832
Genome map
AA seq 483 aa AA seqDB search
MTQTTDKLSTHVSVKEAEMAEVLAKIVRDKYQWVEARKQTQPLDEFKASLTATDRSFYDA
LSGEQTVFITECKKASPSKGLIRDEFDLDYIASVYNNHANAISVLTDEKYFQGDFEFLPK
VRSIAKQPILCKDFMVDTYQVYLARHYSADAILLMLSVLDDEEYQALAEVAHSLNMGVLT
EVSNEEELHRAVALKAKVIGINNRNLRDLSTDLNRTKELAPLIRELATNAVVISESGIYT
HQQVRDLSTFADGFLIGSSLMAEKNLELAVRKVTLGENKVCGLTHSDDAAKAYQAGAVFG
GLIFVEASKRHVDIEAARLTMSGAPLNYVGVFQNHSVADVTKTVSELGLFAVQLHGDESQ
AFVDELKQSIPESVEVWKAYGVASGGENGAKSALPELLKSNVTRHLLDTKVGSQTGGTGQ
AFDWSLINNQSAIMLAGGLNPENANQAAKLGCLGLDLNSGVESAPGKKDADKLQRAFAAI
RNY
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacacagactaccgataaattgtcgacccacgtttcagtcaaagaagctgaaatggcg
gaagtactagcaaaaatcgttcgtgataaataccaatgggttgaagcgcgtaagcagact
caaccactggacgagtttaaagcgtcactaactgcaacagaccgcagcttttatgatgca
ctgagcggcgagcaaaccgttttcatcactgaatgtaagaaggcatcaccgtcaaaaggt
ttaatccgtgacgagtttgatttggactacattgcatcggtttacaacaaccacgccaac
gcgatttcagtgctgacagacgagaaatacttccaaggtgactttgagtttttacctaag
gttcgcagcattgctaagcagcctatcctgtgtaaagacttcatggttgatacctaccaa
gtttacttagctcgtcactactctgcagatgctatcttgttgatgctatcggtattagat
gacgaagagtaccaagcactggcggaagttgctcactcgctcaacatgggtgtcctaacc
gaagtcagtaacgaagaagagcttcaccgcgcagtcgctttaaaagcaaaagtgatcggc
attaataaccgtaacctgcgtgacctttcgactgatttgaaccgtaccaaagagttggct
ccgctgattcgcgaactggctacaaacgcagtcgtgatttcagagtctggcatctacaca
catcaacaagttcgagatctttcaacgtttgcagatggtttcttaatcggcagctctctg
atggctgaaaagaacctagagcttgcagtgcgtaaagtaacactcggtgaaaacaaggtg
tgtggtttaactcactctgacgatgccgcgaaggcttatcaagctggtgcggtgttcggt
ggtttgattttcgttgaagcgtctaagcgtcatgtggatatcgaagcggctcgtttaacc
atgagtggcgcaccgctgaactacgtgggtgtgttccaaaaccacagcgtagcagacgtt
acgaaaacggtatctgagctaggcctattcgctgtgcaactgcacggtgatgagtctcaa
gcatttgttgatgagttaaaacaatcaatacctgaaagcgttgaggtttggaaagcttac
ggtgtggcttctggtggtgaaaacggtgctaaaagcgcgctaccagaattactgaaaagc
aacgtgactcgtcacctgctagatactaaagtgggttctcaaacgggtggtactggccaa
gcgttcgattggagcctaatcaacaaccaaagcgcaattatgttagcgggtggcctaaac
ccagaaaacgctaaccaagccgctaagttaggttgtttaggattagacctaaactctggc
gttgaatcagctccaggtaaaaaagacgcagacaaactgcaacgcgcttttgcagcgatt
cgtaattactag

DBGET integrated database retrieval system