KEGG   Vibrio tasmaniensis: VS_1970Help
Entry
VS_1970           CDS       T00812                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vsp  Vibrio tasmaniensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VS_1970
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VS_1970
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VS_1970
Enzymes [BR:vsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VS_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2113963..2115153
Genome map
AA seq 396 aa AA seqDB search
MAKLDAYFGEYGGQYVPQILVPALDQLEQAFIDAQADPEFRSEFMTLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKQEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSSTLKDACNEALRDWSATY
EDAHYLLGTAAGPHPFPTIVRDFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDENGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYDNVTDDEALEAFQLIARKEGIIAALESSHALAHAVKM
AHDDPEKEQLLVVNLSGRGDKDIFSVHDILKEKGAL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactcgatgcctacttcggtgaatacggtggtcaatacgtaccgcagatccta
gtgccagcactagaccaactagaacaagcatttatcgatgcacaagccgatcctgagttc
cgcagtgaattcatgacgcttctgcaagagtacgccggtcgtccaacggcactaacgcta
acgcgtaacctgactaaaggtacaaaaaccaaactgtacctaaagcgtgaagatctactt
cacggcggtgctcacaagacaaaccaagttcttggtcaagcattgctagcaaaacgtatg
ggtaaacaggaaatcatcgctgaaactggcgcaggccaacatggtgttgcaacggctcta
gcttgtgctctattgggccttaagtgtcgtgtttacatgggtgcaaaagacgttgaacgt
caaagcccgaacgtgttccgtatgaagctaatgggcgcagaggttatccctgttcattct
ggctcttcaacgctaaaagatgcatgcaacgaagcactacgtgactggtctgcaacttat
gaagacgcacactacctgctaggtactgcggctggccctcacccattcccaacgattgtt
cgtgatttccaacgcatgatcggtgaagaaacgaagaaccaaattctagctcgtgaaggt
cgccttcctgatgccgttatcgcttgtgtaggtggtggttctaacgctatcggcatgttc
gctgatttcattgaagaagagtctgttcgcctaatcggtgtagagcctgctggtaaaggt
attgataccgaccaacacggcgcaccacttaaacacggtaaaacaggtattttcttcggt
atgaaagcaccactgatgcaagatgaaaacggccaagtagaagagtcttactctgtttct
gcgggtctagatttcccatcagttggtcctcaacacgcgcacctaaatgcgattggccgt
gctgaatacgacaacgtgaccgatgacgaagcgctagaagcgttccaattgattgcacgt
aaagaaggtattatcgcagcgctagagtcatctcatgctttggctcatgctgttaaaatg
gctcatgacgacccagagaaagaacagctattagtcgttaacttatctggtcgcggtgac
aaagacattttctctgtacacgacattcttaaagagaaaggagcattataa

DBGET integrated database retrieval system