KEGG   Vibrio tasmaniensis: VS_1971Help
Entry
VS_1971           CDS       T00812                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00260  Glycine, serine and threonine metabolism
vsp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01130  Biosynthesis of antibiotics
vsp01230  Biosynthesis of amino acids
Module
vsp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VS_1971
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VS_1971
Enzymes [BR:vsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VS_1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Amidohydro_2 HMGL-like His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAV19148
UniProt: B7VGU8
Position
1:2115153..2115959
Genome map
AA seq 268 aa AA seqDB search
MDRYQSLFTRLAEKNQGAFVPFVTVGDPNPEQSLKIMETLVEAGADALELGIPFSDPLAD
GPTIQGANIRALDSKVTPDVCFDLIGQIRAKYPELPIGLLMYANLVYARGIENFYERCAK
AGIDSVLIADVPTNESGEFVAAAKKFGIHPIFIAPPTASDETLQSVSELGGGYTYLLSRA
GVTGAETKANMPVTALLDRLNKFDAPPALLGFGISAPEQVKEAIVAGAAGAISGSAVVKI
IENNVEQPEAMLKALAEFVTPMKAATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgctatcaatcactattcactcgcttagctgaaaagaatcaaggtgcatttgta
ccattcgtaacggttggcgatcctaaccctgaacagtctcttaagatcatggaaaccttg
gttgaagcgggtgcagatgcacttgagcttggtatcccattctcagatccgcttgccgat
ggcccaacaattcaaggcgcaaacattcgtgctttagattctaaagtaacgccagatgtg
tgttttgatcttattggtcaaattcgcgctaaatacccagagctaccaatcggcctactg
atgtacgcaaacttggtttacgcacgtggtatagaaaatttttacgaacgctgcgcaaaa
gcaggtatcgattcagtactgattgctgatgtaccaaccaacgagagcggcgagtttgtt
gctgcagctaaaaagtttggtattcacccaatctttattgctccaccaacagcaagtgat
gagacgcttcaatcggtttctgagctaggtggtggttacacttacctactttctcgtgct
ggcgtaacgggtgcagaaacaaaagcaaacatgcctgtgactgccctacttgatcgtttg
aacaagtttgatgcgccaccagcactgcttggtttcggtatctcggctcctgaacaagtg
aaagaagcaattgtagctggcgctgcaggtgctatctcgggctcagcagttgtgaaaatc
attgaaaacaacgttgaacaaccagaagcaatgcttaaagcacttgctgagtttgttacg
ccaatgaaagcggcaacgcagaagtaa

DBGET integrated database retrieval system