KEGG   Vibrio tasmaniensis: VS_2146Help
Entry
VS_2146           CDS       T00812                                 

Definition
(GenBank) putative ABC transporter
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00480  Glutathione metabolism
vsp00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    VS_2146
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VS_2146
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VS_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CAV19321
UniProt: B7VHV1
Position
1:2303166..2303711
Genome map
AA seq 181 aa AA seqDB search
MKHSLLCSTALIASLTSSFAFSASCPEILNGKQRLLNSNEEIELCEEFQGKTLLIVNTAS
QCGFTPQFEQLEQLHQTYKDEGFTVVGFPSNDFRQDRGSEKQSAKICYLDYGVTFPMMAR
ASLSGPDANPVFAEIQQQAGIKPKWNFYKFLVSKEGKVIATFPSSTSPTSSTLKNAIEQQ
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattcactgctgtgctccaccgccctaatcgcgagcctaacaagttcattcgct
ttttcagcaagctgccctgagatactcaacggcaaacaaaggctgttaaattcaaacgaa
gaaattgagctgtgtgaagagtttcaaggcaagactttattgatcgtgaatacggcaagc
caatgcggtttcacgcctcaattcgaacaacttgagcagcttcaccaaacgtataaagat
gaaggcttcacggtcgttggtttcccaagtaatgattttcgccaagacagaggaagcgag
aagcaatccgctaaaatctgctacctagattatggcgtcacctttccaatgatggcgcgc
gcttcactctctgggccagacgcaaacccagtctttgccgaaatccaacaacaagccggt
atcaaaccaaaatggaatttctacaagttcttggtcagcaaagaaggcaaagtgatagca
accttcccgagttctacatcgccaaccagtagtaccctcaaaaatgctattgagcaacag
ttatga

DBGET integrated database retrieval system