KEGG   Vibrio tasmaniensis: VS_2241Help
Entry
VS_2241           CDS       T00812                                 

Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00020  Citrate cycle (TCA cycle)
vsp00640  Propanoate metabolism
vsp00660  C5-Branched dibasic acid metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
vsp01130  Biosynthesis of antibiotics
vsp01200  Carbon metabolism
Module
vsp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vsp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VS_2241
   00640 Propanoate metabolism
    VS_2241
   00660 C5-Branched dibasic acid metabolism
    VS_2241
Enzymes [BR:vsp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VS_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: CAV19405
UniProt: B7VI35
Position
1:complement(2407572..2408738)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGFACDTAQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTYQTDANGQPVTKILVEEASNIANELYLGAVVDRATRK
IVFMASTEGGVDIEKIAEETPELIHQSAIDPLVGPQAYQGRELAFKLGLVGDQIKQFVKI
FMGLGQMFSQYDLALLEINPLVITGEGNLLCLDGKINIDSNAMYRQPKLREMHDPSQEDE
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTVPVVVRLEGTNADLGREV
LANSDVDIIAAVSLTDAAQKVVAAAEAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagccaaacagctgtttgcagaattcggtttgcctgtacca
gaaggtttcgcatgtgatactgcacaagaagctttcgaagctgcaggtcgtatcagtaca
gccaagaaagtcgttaagtgtcaagtacacgctggtggtcgcggtaaagcgggcggcgta
gagctacatgacaccaaagaaggcgttaaagagtttgcacaaaagtggctaggtaaaaac
ctagtgacttaccaaacagacgctaatggtcaacctgtaacaaagatcctagttgaagaa
gcatcgaacattgctaacgaactttacctaggtgctgttgttgaccgtgcaacgcgcaaa
attgtattcatggcgtcaactgaaggcggtgtggacattgagaaaatcgctgaagaaact
ccagagttgattcaccaatcagcgatcgatcctctagtgggccctcaagcttaccaaggc
cgtgaacttgcgttcaaacttggtctagttggcgatcaaatcaaacagttcgttaagatc
ttcatgggtcttggccaaatgttctctcagtacgacctagctctactagaaatcaacccg
cttgtaattactggcgaaggcaacctgctttgtctagacggcaagatcaacattgactca
aacgcaatgtaccgtcagccaaagcttcgtgaaatgcacgatccttcacaagaagacgag
cgtgaagcgcacgcagctcagtgggaactgaactacgtagcacttgatggcaacgttggc
tgtatggttaacggtgcaggccttgcgatgggtacgatggatatcgtaaacctacacggc
ggcaagccagcaaacttccttgatgtaggcggcggcgcgacaaaagagcgtgtagctgaa
gcattcaagatcatcctttctgatgacaatgttaaagcagtactcgtaaacattttcggt
ggcatcgttcgttgtgacatgatcgctgaaggtattattggtgcagttaaagaagttggc
gtaacagttcctgtagttgttcgtctagaaggtacaaacgcagacctaggtcgtgaagta
cttgctaattctgatgttgatatcattgctgctgtatctctaacagatgctgctcagaaa
gttgttgctgctgcggaggctaaataa

DBGET integrated database retrieval system