KEGG   Vibrio splendidus: VS_2242Help
Entry
VS_2242           CDS       T00812                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vsp  Vibrio splendidus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_2242
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VS_2242
  Amino acid metabolism
   00310 Lysine degradation
    VS_2242
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VS_2242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2408945..2410150)
Genome map
AA seq 401 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGEAVARDEVIVDIETDKVVLEVPAPEAGVLEAII
EEEGATVLSKQLLAKIKPGAVAGEPTKDTTEDTEASPDKRHKAALTEESNDALSPAVRRL
LAEHNLQPADVKGTGVGGRITREDIDAHLAAAKAAPAASAPAVEAPAAARSQKRVPMTRL
RKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQFEKRHDTRLGFMSFYVKAVTE
ALKRFPEVNASIDGTDIVYHNYFDISMAVSTPRGLVTPVLKDCDTLGFADIEKGIKELAI
KGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRPMAVDGKVEI
LPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARLLLDV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaattctggttccagatttacctgaatctgtggctgatgcaacagttgct
acttggcacaaaaaaccgggcgaagcggttgcacgtgatgaagtcattgtagacatcgaa
acagataaagtagttctagaagtaccggctcctgaagcgggtgttctggaagctatcatt
gaagaagagggtgctacggtactttctaagcagcttcttgcgaaaatcaaacctggtgct
gtcgctggtgaaccaacgaaagacacgactgaagatacagaagcttctcctgataagcgc
cacaaagcggcactgacagaagaaagcaacgacgcactaagccctgctgttcgtcgtctt
cttgcagagcacaacctacaaccagctgacgttaaaggcactggtgttggtggtcgtatt
actcgtgaggacatcgatgcacacctagcagcagcgaaagcggctccggcagcatctgca
ccagcagttgaagcgccagcagcggctcgcagccaaaaacgcgtgcctatgactcgccta
cgtaagacagttgcaaaccgtcttctagaagcgaagaacagcacagcaatgctgactact
ttcaacgaagtgaacatgaagccaatcatggaccttcgtaagcagtacaaagaccaattc
gagaagcgtcacgatacgcgtcttggtttcatgtctttctacgtgaaagcagtaacagaa
gcactgaagcgtttcccagaagttaacgcttctatcgatggtacagatatcgtttaccac
aactacttcgacatcagcatggcggtatctacgccacgtggtttagtgactccagtactg
aaagactgtgacacactaggtttcgcagatattgaaaaaggcatcaaagagctagcaatc
aaaggccgtgacggcaagctaactgttgatgagttgatgggcggtaactttactatcacg
aacggtggtgtatttggttctctaatgtctacgccaatcatcaacccgcctcaagcggca
attttgggtatgcacaaaatccaagatcgtccaatggctgttgatggcaaggttgagatc
ttaccaatgatgtacctagcgctttcttacgatcaccgtctaatcgacggtcgagaatca
gttggcttcctagtgacaatcaaagagctcctggaagatcctgcacgtctgctattagac
gtttag

DBGET integrated database retrieval system