KEGG   Vibrio tasmaniensis: VS_2301Help
Entry
VS_2301           CDS       T00812                                 

Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00300  Lysine biosynthesis
vsp01100  Metabolic pathways
vsp01120  Microbial metabolism in diverse environments
vsp01230  Biosynthesis of amino acids
Module
vsp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    VS_2301
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     VS_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CAV19464
UniProt: B7VIL8
Position
1:2470937..2472073
Genome map
AA seq 378 aa AA seqDB search
MTDSPTLALAKDLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFEDTTNFWARRGTEA
PLFAFAGHTDVVPAGPIEQWNTKPFEPTIIDGFLHGRGAADMKGSLASMVVAVEQFIAKH
PDHTGSIGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEYVGDVVKNGRR
GSITGDLTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDKGNDYFPPTSFQIPNVSA
GTGASNVIPGEFNVQFNLRFSTELNNDIIVERITNTLDKYDFEYDLKWTFNGDPFLTDAG
SLLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMKGQVVELGPVNATIHKVNECVKVAD
LEKLTDMYERTLVNLFAK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagcccaactttggctctggcaaaagacctaatcagccgtcaatcggtaaca
ccagaagatgcaggctgccaagacctgatgattgaacgcttaaaagcgctaggttttgaa
atcgaagtgatggtatttgaagatacgacgaacttctgggctcgccgtggtaccgaagcc
cccctatttgcttttgctggtcacactgatgttgtacctgcaggcccaattgagcagtgg
aacactaagccattcgaaccgactatcatagatggtttcctgcacggtcgcggcgcggca
gatatgaaaggttctctggcttcaatggttgtggctgtagaacagttcattgctaagcac
cctgatcacacaggctcaatcggtttccttatcacgtcagatgaagaaggcccgttcatc
aacgggacagtgcgcgttgtcgaagcattgatggctcgtggtgagaacatcgacatgtgt
attgttggcgaaccatcaagtactgagtacgtaggtgatgtcgtaaagaacggccgtcgt
ggttctatcactggcgatctaacgattaaaggcacacaaggtcacgttgcctaccctcac
cttgcgaacaacccggtacacagctctctgcttgcgatcaatgaattggcgacgaccgag
tgggacaaaggtaatgattatttcccaccaaccagcttccagatcccaaatgtaagtgcg
ggcactggcgcatcaaacgtgattcctggtgaatttaatgttcagtttaaccttcgcttt
agtacagagttaaacaacgacatcatcgttgaaagaatcacaaatacactcgacaagtac
gatttcgaatacgatttaaaatggacattcaatggcgacccgttcttaaccgacgcaggc
tcgttgcttgatgctattgtcgatgcagtaggtcacgtgaatgatgttaagccggcactg
cttaccacaggtggtacttctgacggacgctttattgctcgcatgaagggacaagtggta
gaactaggccctgtgaatgcaaccattcacaaggttaacgagtgcgtgaaagtggctgat
ttagagaaactaactgacatgtacgaaagaacattagtgaacctgttcgctaagtag

DBGET integrated database retrieval system