KEGG   Vibrio tasmaniensis: VS_2346Help
Entry
VS_2346           CDS       T00812                                 

Definition
(GenBank) putative 1-deoxy-D-xylulose 5-phosphate reductoisomeras
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00900  Terpenoid backbone biosynthesis
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VS_2346
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     VS_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: CAV19508
UniProt: B7VIR2
Position
1:complement(2516244..2517329)
Genome map
AA seq 361 aa AA seqDB search
MLALVEKWQPSYVAMACPDAASKLTEVLSTNCPNIKVLSGSEGVCQVASLDEVDTVMAAI
VGAAGLLPTMSAVKAGKRILLANKEALVMSGQLFIDAVDKYGAELLPVDSEHNAIFQCLP
QNVQTNLGRCDLEENGINHILLTGSGGPFRYTDVAELESVTPERAIAHPNWSMGPKISVD
SATMMNKGLEYIEAKWLFNASQEQLKVIIHPQSVIHSMVQYKDGSVLAQMGEPDMATPIA
LTMSYPERTEAGVKPLDFTKVGELTFLEPDLTRYPCLRLAIEACYLGQHATTAINAANEI
AVDAFLNNQVKFTDIAIINEYVMNKVCEQHNSEGLDSLESLLELDNMSRQIAIQFIKEQL
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcgttagttgaaaagtggcaaccaagctatgttgctatggcttgccctgatgca
gcatctaagcttactgaagtgttgtctacgaattgcccaaacatcaaagttctttctggt
tctgaaggcgtgtgtcaggtcgcttctctagatgaagtggacacggtaatggctgctatt
gtgggtgcggcaggtttgcttcctacgatgtctgcggttaaggctggtaagcgcatcttg
ctggctaacaaagaagcgttggtgatgtctggacagttgtttatcgacgccgtagacaag
tacggcgctgaactgcttcctgtcgacagtgagcataatgctatctttcaatgcttgcct
caaaacgtacaaactaacctaggccgttgtgatttagaagagaacggtatcaaccatatt
cttttgactggttcgggtggtcctttccgttatacggacgttgcagagctagagtcggta
acaccagaacgagctatcgcacacccaaactggtcaatgggccctaagatctctgtcgat
tcagcaactatgatgaataaaggcttagagtacattgaggcgaaatggctatttaatgcc
tctcaagagcaactcaaagttattatccaccctcagtctgtgattcattctatggttcag
tacaaggatggctcggtgctcgctcaaatgggcgaacccgatatggcaacgccaatcgct
ttgacgatgtcttatcctgaacgtacagaagcgggtgttaagcctctggatttcaccaaa
gtgggcgagcttaccttcttagagcccgatttaactcgttacccatgtttgagattagcc
attgaggcgtgctatttgggtcagcatgcaacaacagcgattaatgcggcaaacgaaatt
gcagtcgatgctttcttgaacaatcaagtgaagtttaccgatattgctatcattaacgag
tatgttatgaacaaagtatgtgaacaacataactctgagggcttagatagcttggaaagc
cttcttgagctagataatatgtctcgtcaaatagccattcaatttattaaagagcagcta
gcatga

DBGET integrated database retrieval system