KEGG   Vibrio tasmaniensis: VS_2462Help
Entry
VS_2462           CDS       T00812                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00240  Pyrimidine metabolism
vsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VS_2462
Enzymes [BR:vsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VS_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: CAV19621
UniProt: B7VJF7
Position
1:complement(2632525..2633922)
Genome map
AA seq 465 aa AA seqDB search
MVLSHSILPLSLQTILTRVWEALMYLPQEIIRRKRDGEVLTTEEINFFIQGVAKNTVSEG
QIAAFAMAIFFNEMTMPERIALTCAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLM
LGPMVAACGGFVPMISGRGLGHTGGTLDKLESIPGYNITPTNDVFGAVTKEAGVAIIGQT
GDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEAS
EELAKSIVAVANGAGTKTTAILTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLLEITM
ASCAEMLVLGNLAKDSDEAREKLMAVLDNGKAAECFGKMVAGLGGPTDFVTKYDNYLEKA
EIVKPVYALESGVVSAMDTRAIGMAVVGMGGGRRVATDSIDYAVGFDSFIRLGEVASDDK
PLAMIHARNEQQWQEAAKALQNAITVGGEYTATPDVYRQIRSEDV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttaagtcactccatattacctctttccctacaaaccatactcactagagtttgg
gaggcactaatgtatctacctcaagaaattattcgcagaaaacgtgatggtgaagtccta
acgactgaagaaattaacttcttcattcaaggcgtggctaaaaataccgtttctgaaggc
caaattgccgcattcgcaatggctatcttttttaatgaaatgacgatgccagaacgtatc
gcactgacgtgtgcaatgcgtgattcgggcatggtgattgactggagccacatgaacttt
gatggcccaatcgttgataagcactctactggtggtgttggtgacgtaacttctctgatg
cttggccctatggtggcagcatgtggtggtttcgttccaatgatctctggtcgtggttta
ggtcacactggcggtacgctagacaaacttgaatctatccctggttacaatattacaccc
accaacgatgtgtttggtgctgtaaccaaagaagctggcgtagcgatcatcggccaaact
ggtgatttagcgccagctgataagcgcgtttacgcgactcgagatatcacggcaacagtc
gacaacatctcgttgatcacagcttcaattttgtctaagaaattggctgctggtcttgat
tctttagtgatggacgtaaaagtaggttcaggcgcattcatgccgacttacgaagcgtct
gaagagttagcaaaatctatcgttgcagtagcaaacggcgcgggtactaaaacaacggca
atcctaacggacatgaaccaagttctggcttcttcagcgggtaacgcagtagaagtacgt
gaagcggttcaatttctaaccggcgaatatcgtaaccctcgtttgctagaaattacgatg
gcatcgtgtgctgaaatgctggttctgggtaaccttgcaaaagattcagacgaagcgcgt
gaaaaactgatggcagtactggataacggtaaagcagcagagtgcttcggtaaaatggta
gcgggccttggtggtccaactgatttcgtaacgaagtacgataactacctagaaaaagca
gaaattgttaaaccagtgtatgcgctagaaagcggtgtagtatcagcgatggatacgcgt
gcaattggtatggctgtcgttggtatgggcggtggtcgccgcgtagcaacagacagcatt
gattacgcagtcggttttgatagcttcattcgccttggcgaagtagcaagtgacgataaa
ccattagcaatgattcatgctcgcaatgaacaacagtggcaagaagctgcaaaagcatta
caaaatgcaatcactgtgggcggagaatatacagcaacgccagacgtttaccgtcagatt
cgttctgaagacgtgtaa

DBGET integrated database retrieval system