KEGG   Vibrio splendidus: VS_2513Help
Entry
VS_2513           CDS       T00812                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vsp  Vibrio splendidus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vsp00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:vsp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2694570..2696516
Genome map
AA seq 648 aa AA seqDB search
MNYRIDLAVLSEQKNNCRFGLTVHNLSDLDVKDWSLHFAFDRFILPESLSQGELTQVGSY
CSFKPSSSVLKANNHYYLEFSIQSAPFRFYSDGLNDAFIQSHHDGETSVLPVAISPIVLA
SPYRERNQIPEVNASEIALIPQPNQIELKQGSFALSCGCKIEVQSHLADKAVSWLQQELL
STFELSISNELPTEFSKDESGDILFRSNPTLDEAEYKLRITEQQIIVESGSQSGFTHAVA
SLIQLIQQLDAENFSIPCCKIADHPRFKYRGMMLDCARHFHSVEQVKRLINQLAHYKFNV
FHWHLTDDEGWRIEIKSLPQLTEIGAWRGPDHALEPQYTHLADNYGGFYTQQQIREVIEY
AEQRSITVIPEIDIPGHCRAAIKSLPDMLVEQADTTQYKSIQHYNDNVLNPGLPGTYQFL
DAVIEEVAELFPSELIHMGADEVPPGVWTNSPAAQALMKEHQYQDSKDLQGHLFRYAENK
LKQLGKRMVGWEEAQHGDKVSKETIIYSWLSEEAAINCARQGFDVVLQPAQFTYLDMTQD
YAPEEPGVDWAAVIPLEQAYTYEALAEISDTDPIRKRIRGIQCALWCEIVTNQKRMDYMV
FPRISALAEGCWTHKNNRNWLDYLSRLKGHLPLLDRLNVDYRNPWKSE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcgcatcgacttagctgttctttctgaacaaaaaaataactgccgatttggc
cttacggtacataatttaagtgacctcgacgtaaaagattggtctctgcattttgcattt
gaccgattcatccttcctgagagtctatcgcaaggtgaactgactcaagttggaagctat
tgctcgttcaaaccaagttcttcagtattaaaggccaacaaccattactaccttgaattc
agtattcaaagcgccccattccgcttctattctgatggccttaacgatgcctttatccag
tcacatcatgatggagaaacatcggtactgcctgtcgcgatatcacccatagtactggct
tcgccataccgtgaacgcaatcaaatacctgaagttaacgcttctgagatagcattgatt
cctcaaccaaatcagatcgaactcaagcaaggtagtttcgcgctaagctgtggatgcaag
attgaggttcaatctcaccttgcagataaagccgtctcttggttgcagcaagaattactt
tctacctttgaactgtcgatttcgaatgagcttccaacagaattttcaaaagacgaaagc
ggcgacattctatttcgcagcaatccaacattagacgaagcagaatacaaactccgcatt
actgaacaacaaataattgttgaatcaggtagccagtctgggtttacacacgccgtggca
agtctgattcaattgattcaacaactggatgccgaaaatttttctattccatgctgcaaa
atcgccgatcaccctcgctttaagtaccgaggcatgatgttggactgcgcgcgtcacttc
cactcagtagagcaagtgaagcgtttaatcaatcaactggcgcactacaagttcaacgta
tttcattggcacctaactgacgatgaaggttggagaattgagattaagagcctgcctcag
ctgactgaaatcggcgcttggcgcggtcctgatcatgcattagaaccgcaatacacccac
cttgcggataactatggcggcttctacacgcagcaacagattcgtgaagtcattgaatac
gcagagcaacgcagcatcacggtgatcccagagatcgatatcccaggacactgtcgcgcc
gcaataaagtcgctgcctgacatgctggtagagcaagccgacactactcaatacaagagt
attcagcactacaacgacaatgtactaaatccaggcttgccaggtacttatcagttccta
gatgctgtgattgaagaagtcgcagaacttttccctagcgaattgattcacatgggcgca
gatgaagtaccaccgggcgtgtggaccaacagccctgccgctcaagcactgatgaaagag
caccagtatcaagacagcaaagacctacaaggccacctattccgctatgccgagaacaaa
ctcaaacaacttggtaagcgcatggtgggctgggaagaagcacagcacggcgacaaggtg
agcaaagagaccatcatctattcatggctcagtgaagaagccgctatcaattgtgctcgc
caaggctttgatgtggtgctgcaaccagcacagtttacctatctcgacatgacccaagat
tatgcaccggaagaaccgggcgtagattgggctgccgttatccccttagaacaagcttat
acctacgaagccctcgctgagatatccgacaccgatccaattcgtaagcggatccgcgga
attcagtgtgctctatggtgtgagatcgttaccaatcaaaagcgcatggattacatggta
tttccaagaattagcgctttagctgaaggatgttggacacataaaaacaaccgaaactgg
ctagattacctatctcgcctaaagggccacctgccattactcgacagactcaatgttgat
tatcgcaacccttggaaatctgaataa

DBGET integrated database retrieval system