KEGG   Vibrio splendidus: VS_2540Help
Entry
VS_2540           CDS       T00812                                 

Definition
dihydrolipoamide dehydrogenase
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
vsp  Vibrio splendidus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_2540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VS_2540
   00020 Citrate cycle (TCA cycle)
    VS_2540
   00620 Pyruvate metabolism
    VS_2540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VS_2540
   00280 Valine, leucine and isoleucine degradation
    VS_2540
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     VS_2540
Exosome [BR:vsp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VS_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2730181..2731611)
Genome map
AA seq 476 aa AA seqDB search
MSKEIKAQVVVLGSGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVS
KVIEEAKAMAEHGVVFGEPQTDINKIRIWKEKVVDQLTGGLGGMAKMRNVTVVNGFGKFT
GPNSILVEGEGEATTVNFDNAIIAAGSRPIKLPFIPHEDPRIWDSTDALELNEVPEKLLI
MGGGIIGLEMGTVYHSLGSKVEVVEMFDQVIPAADKDIVKVFTKRIKDKFKLMLETKVTA
VEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGALIDAEKAGIEVDERGFINVDKQ
MRTNVPHIHAIGDVVGQPMLAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWV
GKTEKEAKAEGLNYEVATFPWAASGRAIASDCADGMTKMIFDKETHRVIGGAVVGTNGGE
LLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNKKAVKKKK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagaaattaaagcccaagttgttgtacttggttcaggtcctgctggttactca
gcggcattccgttgtgcggatttaggtctagaaacagtactagttgaacgttacagcact
cttggtggtgtatgtctaaacgttggttgtattccatcaaaagcacttcttcacgtatct
aaagtaattgaagaagcaaaagcgatggcagagcacggcgttgtattcggcgagccacag
acggacatcaacaagatccgtatctggaaagaaaaagtagttgatcaactgactggcggt
cttggcggtatggctaagatgcgtaacgttacagttgttaacggttttggtaagttcact
ggtcctaacagcattcttgttgaaggcgaaggcgaagcaacgacagttaacttcgacaac
gcaatcattgctgcgggttctcgcccaatcaaacttccgttcatcccacatgaagaccca
cgtatttgggactctacggatgcattagagctaaacgaagtaccagaaaaactgcttatc
atgggcggtggtatcatcggtcttgagatgggtacggtttaccactctctaggttctaaa
gttgaagttgttgagatgttcgatcaagttatccctgctgcggataaagacatcgttaaa
gtcttcactaagcgcattaaagataagttcaagctaatgcttgaaactaaagtgactgct
gttgaagcgaaagaagacggtatctatgtttcaatggaaggcaaaaaagcaccagctgaa
gctgagcgctacgatgcagttcttgttgctatcggtcgtgttccaaacggtgcacttatc
gacgctgaaaaagcaggtatcgaagttgatgagcgcggtttcatcaatgttgataagcaa
atgcgtactaacgttcctcacatccacgcgatcggtgatgttgttggtcaaccaatgctt
gctcacaaaggtgtgcatgaaggtcacgtagctgctgaagttatctctggtaagaagcac
tacttcgatcctaaagtaatcccatcaattgcgtacactgagccagaagtagcttgggta
ggtaagactgagaaagaagcgaaagcggaaggcctgaactacgaagttgctaccttccct
tgggctgcttctggtcgtgcaatcgcttcagactgtgctgacggtatgactaagatgatc
ttcgataaagagactcatcgcgtaatcggtggtgctgttgttggtactaatggtggtgaa
cttcttggcgaaatcggcctagcaatcgaaatgggttgtgatgcagaagatatcgcactg
actatccacgctcacccaactctacacgagtctgttggtcttgctgcagaagtattcgaa
ggttcaatcactgaccttccaaacaaaaaagcagtgaaaaagaagaagtaa

DBGET integrated database retrieval system