KEGG   Vibrio tasmaniensis: VS_2541Help
Entry
VS_2541           CDS       T00812                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00010  Glycolysis / Gluconeogenesis
vsp00020  Citrate cycle (TCA cycle)
vsp00620  Pyruvate metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
vsp01130  Biosynthesis of antibiotics
vsp01200  Carbon metabolism
Module
vsp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VS_2541
   00020 Citrate cycle (TCA cycle)
    VS_2541
   00620 Pyruvate metabolism
    VS_2541
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VS_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N Biotin_lipoyl_2 HlyD_D23 GCV_H HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: CAV19703
UniProt: B7VK12
Position
1:complement(2731854..2733728)
Genome map
AA seq 624 aa AA seqDB search
MTIEINVPDIGADEVEVTEILVNVGDKVEEEQSLITVEGDKASMEVPASQAGIVKEIKIA
EGDSVSTGSLIMIFEAEGAAAPTAPAVEAAAPVAAAPAAAAELKEVHVPDIGGDEVEVTE
IMVAIGDAVEEEQSLLTVEGDKASMEVPAPFAGIVKEIKIASGDSVSTGSLVMVFEVAGS
GAPVAAAPAPAAAPVAAASAEKEVNVPDIGGDEVEVTEIMVAVGDTVEEEQSLITVEGDK
ASMEVPAPFAGTVKEIKIAAGDKVSTGSSIMTFVVEGAAPVAVAAPAPAQAPAAAPAPKA
EAVAPAAGDFQENGEYAHASPVVRRLAREFGVNLAKVKGTGRKSRVLKEDVQSYVKDALK
RLESGATASGKGGDGSALGLLPWPKVDFSKFGETEVQKLSKIKKISGANLHRNWVMIPHV
TQWDNADITELEAFRKEQNAIEAKKDTGMKITPLVFIMKAVAKALEAFPAFNSSLSEDGE
SIILKKYVNVGIAVDTPNGLVVPVFKDVNKKGIYELSEELMAVSKKARSGKLTAADMQGG
CFTISSLGGIGGTAFTPIVNAPEVGILGVSKSEIKPVWNGKEFQPRLQLPLSLSYDHRVI
DGAEGARFITFLNSALSDIRRLVL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattaatgtaccagacatcggtgctgacgaggttgaagtaactgagatt
cttgtaaacgttggcgacaaggttgaagaagaacagtcactgatcactgttgaaggcgac
aaagcttcaatggaagttcctgcgtctcaagcgggtatcgttaaagaaatcaaaatagca
gaaggcgattctgtttctactggttctcttatcatgatcttcgaagcggaaggtgcagca
gcaccgactgcgccagcagttgaagcggcggcaccagttgcagcagctcctgcagcggca
gctgagcttaaagaagttcacgttcctgatatcggcggtgatgaagttgaagtaactgaa
atcatggtagctattggcgacgcagtagaagaagagcaatctcttcttactgttgaaggt
gacaaggcttcaatggaagttcctgcaccatttgctggtatcgttaaagaaatcaagatc
gcttctggtgattcagtatctactggttctctagtaatggtatttgaagtggcaggttct
ggcgctccagttgccgcagctcctgctccagcggcggcaccagttgcagcagcatctgct
gagaaagaagtgaacgttcctgatatcggtggcgacgaagtagaagttactgaaatcatg
gtagcggttggcgatacagtagaagaagagcaatctctaattactgttgaaggcgacaaa
gcttcaatggaagtgcctgcaccattcgctggtacagtaaaagaaatcaagattgcagct
ggcgacaaagtgtcaacaggctcttcaatcatgactttcgttgttgaaggcgcagctcca
gtagcagtagcggctccagctccagcacaagctccggcagcagcacctgcacctaaagca
gaagcagtagctccagcagctggcgacttccaagagaacggcgagtacgctcacgcatct
ccagttgttcgtcgtctagctcgtgaattcggtgtaaacctagcgaaagttaaaggtact
ggtcgtaagagtcgcgtacttaaagaagacgttcagtcttacgttaaagatgcacttaag
cgtcttgagtctggtgctacagcatctggcaaaggcggcgacggttctgctcttggtcta
ctaccgtggccaaaagttgacttcagcaagttcggcgaaacggaagttcagaagctttct
aagattaagaagatctctggcgctaacctacaccgtaactgggtaatgatcccgcacgtt
acacagtgggacaacgcagacatcactgagctagaagcattccgtaaagaacagaacgca
atcgaagcgaagaaagacactggcatgaagatcactccacttgtgttcatcatgaaagct
gttgctaaagcgttagaagcattcccagcgtttaactcttctctttctgaagatggcgaa
agcatcattcttaagaagtacgtaaacgtgggtatcgctgttgatacaccaaacggccta
gttgttcctgttttcaaagacgtgaacaagaaaggcatttacgagctatctgaagagcta
atggctgtttctaagaaagcacgttctggtaagctaacagcggcagacatgcaaggcggt
tgtttcacaatctctagccttggtggtattggcggtactgcatttactccaatcgtaaat
gctccagaagtaggtatcctaggtgtatctaagtctgaaattaagcctgtttggaatggc
aaagagttccaaccacgtctacagcttccactgtctctatcatacgatcaccgtgtgatc
gatggtgctgaaggtgcacgcttcattactttcctaaacagcgcactatctgacattcgt
cgtctagtactgtaa

DBGET integrated database retrieval system