KEGG   Vibrio splendidus: VS_2541Help
Entry
VS_2541           CDS       T00812                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vsp  Vibrio splendidus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_2541 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VS_2541 (aceF)
   00020 Citrate cycle (TCA cycle)
    VS_2541 (aceF)
   00620 Pyruvate metabolism
    VS_2541 (aceF)
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VS_2541 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2731854..2733728)
Genome map
AA seq 624 aa AA seqDB search
MTIEINVPDIGADEVEVTEILVNVGDKVEEEQSLITVEGDKASMEVPASQAGIVKEIKIA
EGDSVSTGSLIMIFEAEGAAAPTAPAVEAAAPVAAAPAAAAELKEVHVPDIGGDEVEVTE
IMVAIGDAVEEEQSLLTVEGDKASMEVPAPFAGIVKEIKIASGDSVSTGSLVMVFEVAGS
GAPVAAAPAPAAAPVAAASAEKEVNVPDIGGDEVEVTEIMVAVGDTVEEEQSLITVEGDK
ASMEVPAPFAGTVKEIKIAAGDKVSTGSSIMTFVVEGAAPVAVAAPAPAQAPAAAPAPKA
EAVAPAAGDFQENGEYAHASPVVRRLAREFGVNLAKVKGTGRKSRVLKEDVQSYVKDALK
RLESGATASGKGGDGSALGLLPWPKVDFSKFGETEVQKLSKIKKISGANLHRNWVMIPHV
TQWDNADITELEAFRKEQNAIEAKKDTGMKITPLVFIMKAVAKALEAFPAFNSSLSEDGE
SIILKKYVNVGIAVDTPNGLVVPVFKDVNKKGIYELSEELMAVSKKARSGKLTAADMQGG
CFTISSLGGIGGTAFTPIVNAPEVGILGVSKSEIKPVWNGKEFQPRLQLPLSLSYDHRVI
DGAEGARFITFLNSALSDIRRLVL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattaatgtaccagacatcggtgctgacgaggttgaagtaactgagatt
cttgtaaacgttggcgacaaggttgaagaagaacagtcactgatcactgttgaaggcgac
aaagcttcaatggaagttcctgcgtctcaagcgggtatcgttaaagaaatcaaaatagca
gaaggcgattctgtttctactggttctcttatcatgatcttcgaagcggaaggtgcagca
gcaccgactgcgccagcagttgaagcggcggcaccagttgcagcagctcctgcagcggca
gctgagcttaaagaagttcacgttcctgatatcggcggtgatgaagttgaagtaactgaa
atcatggtagctattggcgacgcagtagaagaagagcaatctcttcttactgttgaaggt
gacaaggcttcaatggaagttcctgcaccatttgctggtatcgttaaagaaatcaagatc
gcttctggtgattcagtatctactggttctctagtaatggtatttgaagtggcaggttct
ggcgctccagttgccgcagctcctgctccagcggcggcaccagttgcagcagcatctgct
gagaaagaagtgaacgttcctgatatcggtggcgacgaagtagaagttactgaaatcatg
gtagcggttggcgatacagtagaagaagagcaatctctaattactgttgaaggcgacaaa
gcttcaatggaagtgcctgcaccattcgctggtacagtaaaagaaatcaagattgcagct
ggcgacaaagtgtcaacaggctcttcaatcatgactttcgttgttgaaggcgcagctcca
gtagcagtagcggctccagctccagcacaagctccggcagcagcacctgcacctaaagca
gaagcagtagctccagcagctggcgacttccaagagaacggcgagtacgctcacgcatct
ccagttgttcgtcgtctagctcgtgaattcggtgtaaacctagcgaaagttaaaggtact
ggtcgtaagagtcgcgtacttaaagaagacgttcagtcttacgttaaagatgcacttaag
cgtcttgagtctggtgctacagcatctggcaaaggcggcgacggttctgctcttggtcta
ctaccgtggccaaaagttgacttcagcaagttcggcgaaacggaagttcagaagctttct
aagattaagaagatctctggcgctaacctacaccgtaactgggtaatgatcccgcacgtt
acacagtgggacaacgcagacatcactgagctagaagcattccgtaaagaacagaacgca
atcgaagcgaagaaagacactggcatgaagatcactccacttgtgttcatcatgaaagct
gttgctaaagcgttagaagcattcccagcgtttaactcttctctttctgaagatggcgaa
agcatcattcttaagaagtacgtaaacgtgggtatcgctgttgatacaccaaacggccta
gttgttcctgttttcaaagacgtgaacaagaaaggcatttacgagctatctgaagagcta
atggctgtttctaagaaagcacgttctggtaagctaacagcggcagacatgcaaggcggt
tgtttcacaatctctagccttggtggtattggcggtactgcatttactccaatcgtaaat
gctccagaagtaggtatcctaggtgtatctaagtctgaaattaagcctgtttggaatggc
aaagagttccaaccacgtctacagcttccactgtctctatcatacgatcaccgtgtgatc
gatggtgctgaaggtgcacgcttcattactttcctaaacagcgcactatctgacattcgt
cgtctagtactgtaa

DBGET integrated database retrieval system