KEGG   Vibrio tasmaniensis: VS_2601Help
Entry
VS_2601           CDS       T00812                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vsp  Vibrio tasmaniensis
Brite
Enzymes [BR:vsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VS_2601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_23 Methyltransf_25 RrnaAD Methyltransf_11 DREV CMAS Methyltr_RsmB-F Methyltransf_18 NodS GCD14 Methyltransf_32 Methyltransf_12 MTS DUF938
Motif
Other DBs
NCBI-ProteinID: CAV19796
UniProt: B7VK62
Position
1:complement(2790241..2790867)
Genome map
AA seq 208 aa AA seqDB search
MSNPQAERLVTFLIENGIQDQKVLDAIYLLPRESFLSQAMHHQAYDNNALPIGQGQTISQ
PYIVAKMTELLELQQDSRVLEIGTGSGYQTAVLAQLVDHVYSVERIKSLQWDAKRRLKQL
DFYNISTKHGDGWQGWSSKAPFDAIIVTAAAESIPQALLQQLKDGGRLLIPVGDDEQQLL
KIVRHGDEFLSSVIEMVRFVPLVPGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaatccacaagctgagcgcttagttacttttctgatagaaaatggtattcaggat
caaaaggttcttgatgctatttacttactaccgagagagagctttttatcacaggctatg
catcaccaggcctatgataataatgcgctgcctatcgggcaggggcagacaatttctcag
ccttacattgttgctaaaatgaccgagctgcttgagttacaacaagacagccgcgttttg
gagatcggaacgggttctggttatcaaacggctgttttggctcagttggttgatcacgtg
tattcggttgaaagaataaagtcgctacaatgggatgctaagcgtaggttgaagcaactt
gatttctacaacatctcaaccaagcacggtgatggttggcaaggttggtcttctaaggcg
ccttttgatgcgattattgtcaccgctgctgcagagtcgatccctcaagcgcttttgcag
cagttgaaagatggaggccgcttattaattccggtcggagatgacgaacaacaactgttg
aagattgttcgccacggcgatgagttcttatcgagtgttatcgagatggtgcgatttgta
cctcttgtacctggtgagttagcttaa

DBGET integrated database retrieval system