KEGG   Vibrio splendidus: VS_2744Help
Entry
VS_2744           CDS       T00812                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vsp  Vibrio splendidus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vsp00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vsp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2911779..2913047)
Genome map
AA seq 422 aa AA seqDB search
MMEKFRVIGSDKPLSGEVTISGAKNAALPILFASILAEEPVEVSNVPHLRDIDTTMELLK
RLGAKVSRNGSVHVDGREINEFCAPYDLVKTMRASIWALGPLVARFGEGQVSLPGGCAIG
ARPVDLHIHGLEQLGATIVLEDGYVKASVDGRLKGAHIVMDKVSVGATITIMCAATLAEG
TTVLDNSAREPEIVDTADFLNKLGAKISGAGTDTITIEGVERLGGGQHSVVADRIETGTF
LVAAAVSGGKVVCRNTNAHLLEAALAKLEEAGAKVETGEGWISLDMTDRELKAVKIVTAP
HPGFPTDMQAQFTLLNMMAKGSGVITETIFENRFMHIPELQRMGAKAEIEGNTAICGETE
KLSGAQVMATDLRASASLVIAGCIAQGETIVDRIYHIDRGYDKIEDKLSALGANITRFSE
SN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaagtttcgagttattggatcggataagccgctaagcggtgaagtgacgatc
tcaggcgcaaaaaatgcagccctaccaatcctatttgcttcaattctagctgaagagccg
gttgaagtgagtaatgttcctcacctacgtgacatcgatactacgatggaattgcttaag
cgtttaggcgcaaaagtatcacgcaacggtagtgttcatgttgatggccgcgaaattaat
gaattttgtgcaccttacgatttagtaaaaacaatgcgcgcttctatctgggctttaggt
cctttagtcgctcgttttggtgaaggccaagtgtcacttccgggcggttgtgcaattggt
gctcgacctgttgatttacatatccatggcctagagcaactaggtgcgaccattgtattg
gaagatggttatgtgaaagcaagtgttgatggccgtctgaaaggcgcgcacatcgtgatg
gataaagtaagtgtgggtgccaccattactatcatgtgtgcagcaacattggctgaaggt
acaactgtattagataactcagcgcgagagcctgagattgttgatacggctgatttccta
aacaaactgggtgctaagatttctggcgcaggtacagacacgatcactatcgaaggcgtt
gagcgtcttggtggtggccaacactctgtggttgctgaccgtattgaaaccggtacgttc
ttggttgctgcggcagtgtctggcggtaaagtggtttgtcgcaacaccaacgctcatctt
cttgaagctgcattagcgaagcttgaagaagcgggtgcgaaggttgaaacgggcgaaggt
tggatcagccttgatatgacagatcgtgagctgaaagcggtgaaaatcgtaacagcacct
cacccaggtttcccaaccgacatgcaagcacagtttactctgctcaacatgatggcgaag
ggcagtggtgttatcactgagactatctttgaaaaccgctttatgcacattcctgagtta
cagcgaatgggcgcaaaagcggaaatcgaaggcaacacggctatttgtggtgaaactgag
aagttaagcggcgctcaagtaatggcaacggatcttcgtgcatctgcgagtctagttatt
gctggttgtattgcccaaggcgaaactatcgttgaccgtatttatcacatcgatcgtggc
tacgataagattgaagataaactttcagctttaggcgcaaacattacacgatttagcgag
tcgaactaa

DBGET integrated database retrieval system