KEGG   Vibrio splendidus: VS_2912Help
Entry
VS_2912           CDS       T00812                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vsp  Vibrio splendidus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_2912 (tpiA)
   01230 Biosynthesis of amino acids
    VS_2912 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VS_2912 (tpiA)
   00051 Fructose and mannose metabolism
    VS_2912 (tpiA)
   00562 Inositol phosphate metabolism
    VS_2912 (tpiA)
Enzymes [BR:vsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VS_2912 (tpiA)
Exosome [BR:vsp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VS_2912 (tpiA)
  Exosomal proteins of bladder cancer cells
   VS_2912 (tpiA)
  Exosomal proteins of melanoma cells
   VS_2912 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3063541..3064311
Genome map
AA seq 256 aa AA seqDB search
MRHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSA
IILGAQNSDLNNSGAFTGDMSPAMLKEFGASHIIIGHSERREYHAESDEFVAKKFAFLKE
NGLTPVLCIGESEAQNEAGETVAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAA
TAEDAQRIHAQIRAHIAEKSEDVAKKVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALD
AKSFAAIAKAAAEAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcctgtagttatgggtaactggaaactaaacggcagcaaagaaatggttgtt
gatctactaaacggtcttaacgctgaacttgaaggcgtaacaggcgtagacgtagcagtt
gctccaccagcacttttcgttgatcttgctgagcgtacgcttactgaagcgggcagcgct
atcatcctaggtgctcaaaactctgacctaaacaacagcggtgcattcactggcgacatg
tctccagcaatgcttaaagagttcggcgcatctcacatcatcatcggtcactctgagcgt
cgtgaataccacgctgagtctgacgaattcgttgctaagaaattcgcattcctaaaagag
aacggcctaactccagttctttgtatcggtgaatctgaagcacaaaacgaagcaggcgaa
actgttgctgtatgtgctcgtcaacttgacgctgttatcaacactcaaggtgttgaagct
cttgaaggcgctatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagct
acagctgaagatgcacaacgcatccacgctcaaatccgtgcacacatcgcagagaaatct
gaagacgttgctaagaaagttgttatccaatacggcggttctgttaagccagaaaacgca
gcagcttacttcgcacaaccagacatcgacggtgctctagttggcggcgcagcacttgac
gcgaaaagcttcgcagctatcgctaaagcagcagctgaagcaaaagcttaa

DBGET integrated database retrieval system