KEGG   Vibrio tasmaniensis: VS_2912Help
Entry
VS_2912           CDS       T00812                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00010  Glycolysis / Gluconeogenesis
vsp00051  Fructose and mannose metabolism
vsp00562  Inositol phosphate metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
vsp01130  Biosynthesis of antibiotics
vsp01200  Carbon metabolism
vsp01230  Biosynthesis of amino acids
Module
vsp_M00002  Glycolysis, core module involving three-carbon compounds
vsp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VS_2912
   00051 Fructose and mannose metabolism
    VS_2912
   00562 Inositol phosphate metabolism
    VS_2912
Enzymes [BR:vsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VS_2912
Exosome [BR:vsp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VS_2912
  Exosomal proteins of bladder cancer cells
   VS_2912
  Exosomal proteins of melanoma cells
   VS_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAV20209
UniProt: B7VLN7
Position
1:3063541..3064311
Genome map
AA seq 256 aa AA seqDB search
MRHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSA
IILGAQNSDLNNSGAFTGDMSPAMLKEFGASHIIIGHSERREYHAESDEFVAKKFAFLKE
NGLTPVLCIGESEAQNEAGETVAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAA
TAEDAQRIHAQIRAHIAEKSEDVAKKVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALD
AKSFAAIAKAAAEAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcctgtagttatgggtaactggaaactaaacggcagcaaagaaatggttgtt
gatctactaaacggtcttaacgctgaacttgaaggcgtaacaggcgtagacgtagcagtt
gctccaccagcacttttcgttgatcttgctgagcgtacgcttactgaagcgggcagcgct
atcatcctaggtgctcaaaactctgacctaaacaacagcggtgcattcactggcgacatg
tctccagcaatgcttaaagagttcggcgcatctcacatcatcatcggtcactctgagcgt
cgtgaataccacgctgagtctgacgaattcgttgctaagaaattcgcattcctaaaagag
aacggcctaactccagttctttgtatcggtgaatctgaagcacaaaacgaagcaggcgaa
actgttgctgtatgtgctcgtcaacttgacgctgttatcaacactcaaggtgttgaagct
cttgaaggcgctatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagct
acagctgaagatgcacaacgcatccacgctcaaatccgtgcacacatcgcagagaaatct
gaagacgttgctaagaaagttgttatccaatacggcggttctgttaagccagaaaacgca
gcagcttacttcgcacaaccagacatcgacggtgctctagttggcggcgcagcacttgac
gcgaaaagcttcgcagctatcgctaaagcagcagctgaagcaaaagcttaa

DBGET integrated database retrieval system