KEGG   Vibrio splendidus: VS_2942Help
Entry
VS_2942           CDS       T00812                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vsp  Vibrio splendidus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_2942
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VS_2942
   00620 Pyruvate metabolism
    VS_2942
   00640 Propanoate metabolism
    VS_2942
  Energy metabolism
   00680 Methane metabolism
    VS_2942
Enzymes [BR:vsp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VS_2942
Lipid biosynthesis proteins [BR:vsp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VS_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3100422..3102371
Genome map
AA seq 649 aa AA seqDB search
MSEAHVYPVKENIKSTTHADNDTYLAMYQQSVSDPEGFWGEHGKIVDWIKPFTQVKNTSF
DPGHIDIRWFEDGTLNVSANCIDRHLAERGDEVAIIWEGDDPADDKTLTFNELHKEVCLF
SNALKEQGVRKGDVVCLYMPMVPEAAVAMLACTRIGAVHTVVFGGFSPEALSGRIIDSNS
KVVITADEGVRGGRAVPLKKNVDEALTNPEVKNIEKVVVFKRTGGDVAWHEHRDVWWHDA
IANVSADCPPEEMNAEDPLFILYTSGSTGKPKGVMHTTGGYLVYAAMTFKYVFDYQEGET
FWCTADVGWITGHTYLVYGPLANGAKTILFEGVPNYPNTSRMSEVVDKHQVNILYTAPTA
IRALMAKGNEAVEGTSRDSLRIMGSVGEPINPEAWEWYYKTIGNEQSPIVDTWWQTETGG
ILIAPLPGATDLKPGSATRPFFGVQPALVDNMGNIIEGATDGNLVILDSWPGQMRTVHGD
HDRFEQTYFSTFKGMYFTSDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESALVAFD
KIAEAAIVGIPHDIKGQAIYAYITLNDGEFPTAELHKEVKDWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIATGDTGNLGDTSTLADPSVVDKLIAEKAELA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcccacgtttatccggtaaaagaaaatattaaatcaaccacacacgcggat
aatgacacttacctagccatgtaccagcaatctgtttctgaccctgaaggcttttggggt
gaacacggaaaaatcgttgattggattaaacctttcacacaggtaaaaaatacctctttc
gaccctggccacattgatattcgctggtttgaagatggcacgcttaacgtttcggctaac
tgtatcgaccgccaccttgctgaacgcggcgatgaagtcgctattatctgggaaggcgat
gacccggcggatgacaaaactctaacttttaatgaactacacaaagaagtgtgcctgttt
tcgaatgctctgaaagagcaaggcgtgcgcaaaggcgatgtggtttgtttatacatgcca
atggttcctgaagctgcagtagccatgctggcgtgtacccgtataggtgcggttcacaca
gtagtatttggtggtttctcaccagaagcactgtctggtcgtattatcgattcaaattct
aaagtcgttatcactgccgatgaaggcgtgcgtggcggccgtgctgttccactgaagaaa
aatgtcgatgaagcactgacgaatcctgaagtgaagaacatcgaaaaggttgtagtattc
aaacgtactggcggcgatgttgcatggcacgaacaccgcgatgtgtggtggcacgatgct
attgctaatgtatctgcagattgtcctccagaagagatgaacgcagaagacccactattc
atcctttatacgtcaggttcaacaggcaaacctaagggtgttatgcacaccacaggtggt
taccttgtttatgcagcaatgaccttcaaatacgtattcgattaccaagaaggcgaaact
ttctggtgtacagccgatgtgggttggattaccggtcacacataccttgtttacgggcca
ctagccaatggtgcaaaaaccattctgtttgaaggcgtgccgaactacccgaacacaagc
cgcatgagtgaagtggtcgataagcaccaagttaatattctttatacggcgccaacagct
attcgtgcattgatggcgaaaggcaatgaagccgttgaaggcacgtctcgtgacagccta
agaatcatgggctcagtgggtgaacctatcaacccagaggcgtgggagtggtactacaaa
acaatcggtaatgagcagtctccaattgttgatacatggtggcaaacagaaacgggtggt
atcttaatcgcaccactaccgggggcaaccgatctaaaaccgggctcagcgacgcgtcca
ttcttcggtgtgcaaccggcgctggttgataacatgggtaacatcattgagggtgcaaca
gacggcaacctagtgattcttgactcttggccaggccagatgcgtaccgttcacggcgat
catgaccgtttcgaacaaacttacttctcgacctttaaaggcatgtacttcaccagtgat
ggtgctcgtcgtgatgaagacggttactactggattactggccgtgttgatgacgttctg
aacgtatcaggccaccgtatgggtaccgctgagattgaatcggctctagtcgcatttgat
aagatcgcagaggctgcgattgtaggtatccctcatgatattaaaggccaagcgatttac
gcttacatcacgttgaatgatggtgaatttccgaccgcagagcttcataaagaagtgaaa
gactgggtacgcaaagagataggcccaatcgcaacgccagatgtactgcactggaccgac
tcattaccaaaaactcgttcaggtaaaatcatgcgtcgtatcctgcgtaagattgccact
ggcgatactggcaacctaggcgatacgtcgacactggcagacccaagcgtggtcgataag
ctgattgcagagaaagcggaactggcataa

DBGET integrated database retrieval system